Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "blue"

1. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

2. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

3. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

4. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

5. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

6. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

7. In the dark blue sky you keep

8. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

9. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

10. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

Random Sentences

1. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

2. Can you please stop beating around the bush and just tell me what you really mean?

3. The beaten eggs are then poured into a heated and greased pan.

4. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

5. She is not designing a new website this week.

6. Marahil ay hindi pa sapat ang oras na nakalaan para matapos ang proyekto.

7. Gaano kalaki ho ang gusto niyo?

8. Ang mga bayani ay mga taong nagsakripisyo para sa kalayaan at kabutihan ng bayan.

9. Papanhik din sana siya sa tuktok ng burol subalit naabot siya ng rumaragasang tubig-ulan na lalong nagpalalim sa dagat-dagatan.

10. Ayaw ng kaibigan ko ang mainit na panahon.

11. Dahil dito, walang may gustong makipagkaibigan sa kanya.

12. Hindi ako sumang-ayon sa kanilang desisyon na ituloy ang proyekto.

13. Nangahas ang bata na tawirin ang ilog kahit hindi marunong lumangoy.

14. They must maintain transparency and communicate with their constituents to build trust and ensure representation is effective.

15. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

16. Dapat bigyang-pansin ang pangamba ng mga bata at tulungan silang maunawaan ang mga posibleng banta.

17. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

18. Ein frohes neues Jahr! - Happy New Year!

19. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

20. Inflation kann die Preise von Vermögenswerten wie Immobilien und Aktien beeinflussen.

21. El puntillismo es una técnica de pintura que utiliza pequeños puntos de color para crear la imagen final.

22. Elle adore les films d'horreur.

23. Nasaktan, nagalit din ang lola at gumanti.

24. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

25. Hindi ko na kayang panindigan ang aking pagkatao dahil sa inis na nararamdaman ko.

26. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

27. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

28. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

29. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

30. Stop beating around the bush and tell me what's really going on.

31. Ang pagkakaroon ng mapagkakatiwalaang kaibigan ay siyang ikinagagalak ni Carla.

32. Sa dakong huli, na-realize ko na mahalaga ang aking mga kaibigan.

33. Tumango siya at nagsimula nang kumaen.

34. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

35. Sige na. Kami na lang bahala dito. sabi sa akin ni Grace

36. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

37. The project gained momentum after the team received funding.

38. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

39. Maglalakad ako papunta sa mall.

40. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

41. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

42. Where we stop nobody knows, knows...

43. Nanalo siya sa song-writing contest.

44. Pakain na ako nang may dumating na bisita.

45. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

46. They do not skip their breakfast.

47. Nationalism is often associated with symbols such as flags, anthems, and monuments.

48. Napatungo ako dahil nangingilid na naman ang mata ko.

49. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

50. The elephant in the room is that the company is losing money, and we need to come up with a solution.

Similar Words

nakablueblues

Recent Searches

bluelegislativeshowlorimagitingshouldpackagingdoonmakilingnananaginippagkakayakapdugonagngangalangnagtatakbonagtuturosustentadonagtrabahonakumbinsitinatawaghumiwalayentrancenawalangminu-minutopagkapasokbayawakbusinesseshandaannakakatandafitnesspinakidalapalancadaramdaminumakbaydisfrutarmensahehayaanpresidentekabutihanmaintindihanmagpapakabaitskyldes,apatnapumagturoopobuwenaskommunikerershapingintramuroskontinentengsagutindiyanmarketing:tumamakagubatanevolucionadonatalomensika-50makilalaumangatmahabolmagawalagnatuniversitiesbinasanuevosmaluwagkalakingbayaniisinalaysaytindahantapatmiyerkolesnapakominamasdandiseaseperwisyomarilouparehasapologeticmatesaangheltanongkahusayansumisidkasaleneromatitigassinepinagkasundohdtvoperahanmabiroitutolalaalamaskihuwebeslendingdaladalanakatinginglalaasthmaanaysubalitiguhitwatawatshopeebaromakaratingwatchingsumamapostcardkabibinatanggappitogalitconvertidasschoolslatestfencingviewsemphasisfaultkitangstudentthroughoutipasokinuminfloorhomeworkdumatingbumababetweenremembercontrolledamountusemapnaglalarolearningcurrentfourdinadaananpagkuwandahilcruztig-bebenteyorkpaglalabakasabayitinaliporlalakimakauuwigayunmanrenombremagkakaanakposporokinakitaannapaplastikankomunikasyonkare-karepaglisaninakalangnakasandigjobspamilyamalalimnakakagalamagpalibrenakakagalingmang-aawithinipan-hipankumbinsihinyunpalabuy-laboyalas-diyesgandahanhiwanagmistulangrebolusyonpinaghatidanreviewistasyonkumakantamarahashimihiyawtaga-hiroshimaipinikitnamataypaghuhugassharmainediretsahangnapakahusaybowlnagsmilepagkaaware-reviewmahahawailigtas