Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "blue"

1. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

2. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

3. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

4. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

5. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

6. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

7. In the dark blue sky you keep

8. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

9. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

10. Verified accounts on Twitter have a blue checkmark, indicating that they belong to public figures, celebrities, or notable organizations.

Random Sentences

1. The feeling of finishing a challenging book can be euphoric and satisfying.

2. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

3. We admire the courage of our soldiers who serve our country.

4. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

5. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

6. Los padres pueden prepararse para el nacimiento tomando clases de parto y leyendo sobre el proceso del parto.

7. Ang mga magsasaka ay nagtatanim ng palay.

8. Owning a pet can provide companionship and improve mental health.

9. He has improved his English skills.

10. Sa panahon ng pandemya, maraming tao ang naging nag-iisa dahil sa lockdown.

11. Kapag ako'y nasa eroplano, natatanaw ko ang iba't ibang mga pook sa ibaba.

12. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

13. Arbejdsgivere kan fremme mangfoldighed og inklusion på arbejdspladsen for at skabe en retfærdig arbejdsmiljø for alle.

14.

15. Las comidas calientes y reconfortantes, como sopas y guisos, son populares en invierno.

16. Magtaka ka na kung hindi pa sya umuuwi bukas.

17. Sino ang puwede sa Lunes ng gabi?

18. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

19. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

20. Mathematics can be used to analyze data and make informed decisions.

21. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

22. Asegúrate de que el área esté libre de maleza y que el suelo sea bien drenado

23. La prevención del uso de drogas es fundamental para reducir los índices de adicción.

24. Pumasok ako sa cubicle. Gusto ko muna magisip.

25. Naiinlove ako nang lubusan sa aking nililigawan dahil napakasaya ko tuwing kasama ko siya.

26. Gusto ng mga batang maglaro sa parke.

27. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

28. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

29. Omelettes are a popular choice for those following a low-carb or high-protein diet.

30. The sun sets in the evening.

31. Natuto siyang lumaban sa kaniyang mga magulang.

32. Maaliwalas ang mukha ni Lola matapos siyang bisitahin.

33. Muntikan na akong mauntog sa pinto.

34. Effective use of emphasis can enhance the power and impact of communication.

35. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

36. Effective use of emphasis can enhance the power and impact of communication.

37. Ang aming washing machine ay madalas magamit dahil halos araw-araw kaming naglalaba.

38. Sa pagbisita sa hardin, ang mga bulaklak ay nagbigay ng mabangong amoy at kagandahan sa kapaligiran.

39. Pangako ng prinsipe kay Mariang maganda.

40. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

41. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

42. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

43. Peter Pan takes children on an adventure to Neverland, where they never grow up and encounter pirates and fairies.

44. Sumasakay si Pedro ng jeepney

45. Ang pag-asa ay nagbibigay ng mga solusyon sa mga problema at hamon sa buhay na hindi magagawan ng paraan.

46. Inumin mo ang gamot nang minsan isang araw.

47. The weather today is absolutely perfect for a picnic.

48. At sana nama'y makikinig ka.

49. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

50. Ako ang mas nagulat nang hapasin ni Maico sa hita si Mica.

Similar Words

nakablueblues

Recent Searches

nakatulogbluepublishing,putahecolourfamilypasensyabaranggayiloilocourtpoliticalnakikini-kinitataxilinastorypanaloehehebalangasukalcanadahealthierulammembersiligtaskinagalitanbesesmariloudaangganangcampaignsmagmulaunti-untinglumiwagmalimitmaanghangnamehinampasdalagangmatabangbihiraresearch,dyipreservationtulangmayamannamataysaidnakakatawamataaaspagpapatubopaki-ulitpelikulamagbibigaypaglalayagbeintemakikipag-duetoperfectsahodgranadanamcontent,modernenakakagalinglagaslasnoonpalitaninismahabolmamarilpeeppiratapambahayhimselfsakimoncepinyamalabomedidaputolmagbagong-anyonapakahusaytignannaglahoforcesevenstoremay-bahaymagtanimmahalgawanideologiesnapalitangbukasnanlilimahidnakapagproposeallowsbetweenpumatolnagsamanakinigestudyantethemstatusleadersconditioningnagliwanagcornerstrategyrisknanghihinamadelviskumidlatresortibinentanagtatanongtumibaypaumanhinsilapagdiriwangpanitikannaggingbaliwkulanganyanimonapakabilisandamingmulighedathenalineutilizaralignsisubopaakyatabut-abotbigkare-kareaaisshprogressexamplelumalangoynagkakakainkumakalansingasignaturasinundokapilingenforcingsubalitkapangyahiranalingpare-parehoiphonenatabunantinikstopitinanimroboticslaptoplibopalayansistergasolinachristmaskasingbangnightsabaymababatidendmumuraomelettepulonginternacionalnalagutankamoteambaggabepokerbumaligtadpromoteaayusinthroughoutpangalanankindlemapadalipumuntanicoiyonpakikipagbabag1960smabigyanwatermabibingiamparopanalanginbanknagtrabahobisitanagpapaitimpagkapanalo