Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "first"

1. Ariana first gained fame as an actress, starring as Cat Valentine on Nickelodeon's shows Victorious and Sam & Cat.

2. Bitcoin is the first and most well-known cryptocurrency.

3. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

4. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

5. Foreclosed properties can be a good option for first-time homebuyers who are looking for a bargain.

6. George Washington was the first president of the United States and served from 1789 to 1797.

7. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

8. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

9. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

10. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

11. He's always the first one in the office because he believes in the early bird gets the worm.

12. His first hit, That's All Right, was released in 1954 and quickly climbed the charts

13. I don't want to cut corners on this project - let's do it right the first time.

14. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

15. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

16. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

17. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

18. Kukuha lang ako ng first aid kit para jan sa sugat mo.

19. LeBron spent his first seven seasons with the Cleveland Cavaliers, earning the nickname "King James" for his dominant performances.

20. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

21. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

22. Nangahas siyang tumulong sa biktima ng aksidente kahit wala siyang kaalaman sa first aid.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. The first dance between the bride and groom is a traditional part of the wedding reception.

25. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

26. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

27. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

28. The invention of the telephone led to the creation of the first radio dramas and comedies

29. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

30. The Tesla Roadster, introduced in 2008, was the first electric sports car produced by the company.

31. The United States has a Bill of Rights, which is the first ten amendments to the Constitution and outlines individual rights and freedoms

32. They offer interest-free credit for the first six months.

33. Tobacco was first discovered in America

Random Sentences

1. Ang mga halaman sa bukid ay natutuyo dahil sa matinding tagtuyot.

2. You're stronger than this, pull yourself together and fight through the tough times.

3. Supporting policies that promote environmental protection can help create a more sustainable future.

4. Ang sakit niya ang nakapanghihina sa kanya.

5. She has been knitting a sweater for her son.

6. Nogle helte er berømte idrætsstjerner.

7. Ang pagguhit ay isang paraan upang maipakita ang iyong talento.

8. Ang daddy ko ay masipag.

9. Tulala siyang tumitig sa malawak na tanawin ng dagat.

10. Isa kang hampaslupa! saad ng matapobreng babae.

11. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

12. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

13. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

14. Sinong may sabi? hamon niya sa akin.

15. Nasa silid-tulugan ako at nagitla ako nang biglang bumukas ang bintana sa malakas na hangin.

16. Babasahin ko? medyo naiilang kong sabi.

17. Drømme kan være en kilde til inspiration og kreativitet.

18. La paciencia es una virtud que nos ayuda a ser mejores personas.

19. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

20. Ako ay nagtatanim ng mga puno sa aming lugar upang mapanatili ang kalikasan.

21. Lalong nagalit ang binatilyong apo.

22. Sa paligsahan, ang pinakamataas na saranggola ang nanalo.

23. Museum Nasional di Jakarta adalah museum terbesar di Indonesia yang menampilkan berbagai koleksi sejarah dan budaya Indonesia.

24. Nabasa niya ang isang libro at matapos niyang basahin, naglimot na agad siya sa mga pangunahing detalye ng kwento.

25. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

26. The package's hefty weight required additional postage for shipping.

27. Ang lecture namin sa klase ay ukol kay Andres Bonifacio at ang mahahalagang pangyayari sa kasaysayan.

28. Matagal-tagal ding hindi naglabada ang kanyang ina, nahihiyang lumabas sa kanilang barungbarong.

29.

30. Sa sobrang antok, aksidente kong binagsakan ang laptop ko sa sahig.

31. Malilimutin si Marco kaya’t laging paalala ang sinasabi ng kanyang ina.

32. Hinde pa naman huli ang lahat diba?

33. Las escuelas ofrecen actividades extracurriculares, como deportes y clubes estudiantiles.

34. Maraming bansa ang nagsimula ng digmaan dahil sa territorial disputes.

35. Si Ogor, na kamakailan lamang ay bumabag sa kanya, ang malimit magsisimula ng panunukso.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Thumbelina is a tiny girl who embarks on a journey to find true love and her place in the world.

38. Ang marahas na pag-atake ay labag sa batas at maaaring magdulot ng malubhang parusa.

39. Matagal akong nag stay sa library.

40. La labradora de mi amigo es muy valiente y no le teme a nada.

41. Nagising si Rabona at takot na takot na niyakap ang kaniyang mga magulang.

42. Mon mari et moi sommes mariés depuis 10 ans.

43. Pakiluto mo nga ng pancit ang mga bata.

44. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

45. Don't give up - just hang in there a little longer.

46. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

47. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

48. Saan ka galing? Dalawang araw na ako dito ah! aniya.

49. Instagram also supports live streaming, enabling users to broadcast and engage with their audience in real-time.

50. Pwede mo ba akong tulungan?

Recent Searches

classmateblessshouldfirstproduktivitetniyangnapag-alamanmakasahodfacemaskanaytinderamagpasalamatlendinglumipadpoliticsmanggagalingkalyefeelingfuellabingbuwaldingdingbagsakmeriendaetocomunesiniinompagdukwangshowlibrodatapwatmaunawaanmaingaylordkaramisummitnamuhayandrespowerssumamagasolinatumalimkidkiranmagbibigaynagsmiletumahanpagkaraanaglokosundhedspleje,mashanap-buhaymangkukulampresidentehayaannalalabingtumakaspagdudugoprovepresence,nabighaninakikitangpinagmamalakipagka-maktoldi-kawasarecibirginagawapostcardparinnyadahonkinauupuaninferioresnalalaglagnaglipanangnagsunurannanlilimahidlumalangoykinatatakutanprimerosmakikipag-duetopamilihaneditnagpagupitkare-kareuusapanmakasilongpaghihingalohinimas-himasentrancepaumanhinmagpagalinghawaiimagtakamamalasamericana-fundjuegospaghaliknakataashalu-halodispositivosvaccineskapitbahaytemperaturanatuwaprincipalessagutinculturasumiisodpoliticalkilongnahigitanmagpuntabumilituwamanalokamingmabibinginakainnatakotfreedomspinapakinggansandwichjulieteroplanosaritauwakgelaisinehanpinipilitkaratulanggawaindiyaryonakapagproposenabuhayrodonanapagodparoroonabobotokapalcompletamentebagonginintaylinalubosthanklalimbibigyansikatsocietynagplayberetikanilaaustraliakaraokemasamangingisi-ngisingsangapusamasipagpinagmagnifyejecutantogethersakimhinabollaranganmangingibigdisyembredibapaskongpagputikahitkasaysayancapacidadcubiclesacrificenyanresortgoshklasrumkatandaansamahannunopriestparkingzoobumigaynatandaaningatansarongmedicinedilimklimakanya-kanyangbarnesmasknatanggapimportantesradio