Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "machines"

1. Computer vision is another field of AI that focuses on enabling machines to interpret and analyze visual data.

2. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

3. Modern civilization is based upon the use of machines

4. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

5. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. The sports center offers a variety of activities, from swimming to tennis.

2. Tengo fiebre. (I have a fever.)

3. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

4. Kapag hindi tama ang timpla ng pulotgata, maaaring maging mapakla o mapait ito.

5. Magdamag na bukas ang ilaw sa kwarto.

6. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

7. Weddings are typically celebrated with family and friends.

8. Subalit pinipilit pa rin niyang maging malakas bagamat talagang di na kaya ng kaniyang pang tumayo ng kahit ilang sandali man lang.

9. Hindi sadyang nasaktan siya nang malaman niyang iniwan siya ng kanyang kasintahan.

10. The first microscope was invented in the late 16th century by Dutch scientist Antonie van Leeuwenhoek.

11. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

12. L'hospitalisation est une étape importante pour de nombreuses personnes malades.

13. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

14. The United States has a system of federalism, where power is divided between the national government and the individual states

15. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

16. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

17. Ngunit isang sugatang pirata ang nagkaroon pa ng pagkakataong mamaril bago ito binawian ng buhay.

18. They have been cleaning up the beach for a day.

19. Tinangka umano ng pulis na kausapin ang mga nagpoprotesta bago sila buwagin.

20. Hindi ako masyadong mahilig sa pagpupuyat sa hatinggabi dahil masama ito sa kalusugan.

21. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

22. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

23. They admire the way their boss manages the company with fairness and efficiency.

24. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

25. Sweetness can be used in savory dishes, such as sweet and sour chicken and honey-glazed ham.

26. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

27. Ayos ka lang ba mahal ko, bakit parang namumutla at namamayat ka? tanong ng binata.

28. Durante la época renacentista, se desarrollaron las primeras formas de música instrumental, como la guitarra y el clavicémbalo

29. Hinanap niya lahat ng kabarkada niya sa sugal at sinisi sa nangyari sa kanya.

30. I just got around to watching that movie - better late than never.

31. Los héroes a menudo arriesgan sus vidas para salvar a otros o proteger a los más vulnerables.

32. High blood pressure can often be managed with a combination of medication and lifestyle changes.

33. The United States is the third-largest country in the world by land area and the third most populous country in the world.

34. Ipantalop mo ng kamote ang kutsilyo.

35. It was founded by Jeff Bezos in 1994.

36. Don't give up - just hang in there a little longer.

37. You need to pull yourself together and face the reality of the situation.

38. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

39. AI algorithms can be used to automate tasks and improve efficiency in industries such as manufacturing and logistics.

40. The momentum of the athlete propelled him across the finish line.

41. Los alimentos ricos en calcio, como los productos lácteos y el tofu, son importantes para la salud ósea.

42. May galak na sumusuno sa kanyang dibdib habang pinagmamasdan ang pagkapuno ng sinundang balde.

43. Sinundan ito ngunit nawala nang sumuot sa nakausling ugat ng puno.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

46. Nahihilo ako dahil masyadong maalog ang van.

47. Arbejdsgivere søger pålidelige og punktlige medarbejdere.

48. Tak kenal maka tak sayang.

49. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

50. Lending money to someone without collateral is a risky endeavor.

Recent Searches

machinesalaymangingisdaschoolsibalikprobablementemaskmasdanmallzoomolivia1980sabihingtelangpakainomelette1876sanorugagreatibigprofessionalcigarettesminutelinefeelsumugodhumanoscoatreservedheartbeateskuwelabubongislameangenerationerprivateharmfulsumapitmatabaeveningtheremichaelstatecomputereuponstuffedgenerateimaginggrabeableprogramming,draft,termpacetypesannapuntanaligawlarawankundimemorialpaligsahanmalakasmunabinililapiscedulapusaaniamountahasgloriadescargarnagkakasyathenpublicationtalagamarangalsinasabisettingparkingcarolnangingisaypagkahapokumatokgurotatawagandekorasyonnakalagaybuung-buoagam-agamnaguguluhangpamamasyalmerlindatinatawagmakikipagbabaghinahanapejecutanpinasalamatancancergumagamithampaslupapagtataasnagmadalingnagawangtalententranceuusapanna-suwaykonsentrasyonanibersaryonaglalatangmagpa-checkupculturakinamumuhianvideos,nakapagngangalitagwadorbarcelonanuevoskanayangjulietcynthiaisinalaysayhinamaktindahanpasaheininomkisamevictoriabintanaadvancementdireksyonmangingisdangpasaheroregulering,nabigyanpropesorkanyamaaliwalaspersonalmangyarinapahintolabinsiyammaintindihanlalabhanmanahimikkilongmatagpuanbeautynagsuotmerrylumisankapalligaligalagahinampasshadesdyosapakibigaylaganapmagdilimlugawpagdaminapapatinginkinadiapernahulogfederalhinintaypatongquarantinetiyanbatiganitomasipagarkilaparoroonaatensyonbiyasaaisshbooksbalingannochebusilakvidtstraktnamamanghamagigitingknighttamasapotsapatorganizeinakyatayawgayunpamaninalagaanmayabanglumulusob