Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "uso"

1. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

2. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

3. El uso de drogas es un problema grave en muchas sociedades.

4. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

5. El uso de las redes sociales está en constante aumento.

6. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

7. Es importante educar a los jóvenes sobre los riesgos y peligros del uso de drogas.

8. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

9. La prevención del uso de drogas es fundamental para reducir los índices de adicción.

10. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

11. Los adolescentes son especialmente vulnerables al uso de drogas debido a la presión social y la curiosidad.

12. Los efectos a largo plazo del uso de drogas pueden ser irreversibles.

13. Utiliza métodos orgánicos para combatirlas, como el uso de polvos de hierbas o infusiones

Random Sentences

1. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

2. Hindi ko kayang mabuhay ng mayroong agam-agam sa aking buhay.

3. No pain, no gain

4. Ang pusa ay nasa ilalim ng upuan.

5. Sinimulan ko ng basahin sa entry kung saan nakabuklat.

6. Hinugot niya ang kanyang karanasan sa trabaho upang makapagsimula ng sarili niyang negosyo.

7. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

8. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

9. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

10. Andrew Jackson, the seventh president of the United States, served from 1829 to 1837 and was known for his expansion of democracy and his controversial policies towards Native Americans.

11. Nagpalipad ng saranggola si Juan sa bukirin.

12. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

13. Ano ho ang gusto ninyong orderin?

14. Wala yun, gusto ko rin naman sanang pumunta dito eh.

15. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

16. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

17. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

18. Ang bilis natapos ng palabas sa sinehan.

19. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

20. Maganda ang kulay ng mga puno sa panahon

21. ¡Feliz aniversario!

22. Kinakailangan niyang kumilos, umisip ng paraan.

23. Babyens første skrig efter fødslen er en betydningsfuld og livgivende begivenhed.

24. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

27. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

28. Gusto ko dumating doon ng umaga.

29. Nang buksan ng mga tao ang ilang bunga ng punong-kahoy, kanilang nakitang ang balat ay makapal at ang buto ay malaki, ngunit ang laman nama'y matamis

30. Nasa harap ng bangko ang bus stop.

31. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

32. Software er også en vigtig del af teknologi

33. Pakiluto mo nga ng pancit ang mga bata.

34. Limitar la ingesta de alcohol y cafeína puede mejorar la salud en general.

35. Nakapaglaro ka na ba ng squash?

36. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

37. Diretso lang, tapos kaliwa.

38. Women have a higher life expectancy compared to men, on average.

39. A couple of songs from the 80s played on the radio.

40. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

41. Ang pangalan niya ay Ipong.

42. Sige na, sabihin mo na yung mga gusto mong sabihin sa akin.

43. Wag mo ng pag-isipan, dapat pumunta ko.

44. Malilimutin si Marco kaya’t laging paalala ang sinasabi ng kanyang ina.

45. My husband surprised me with a trip for my birthday, and I couldn't be happier.

46. The company's growth strategy is focused on acquiring more assets.

47. You need to pull yourself together and face the reality of the situation.

48. May I know your name for networking purposes?

49. Natawa nanaman sya, Hindi, maganda sya.

50. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

Similar Words

LulusogmalusogpalusotpusopusongngusohusotusonglumusoblumulusobnapakalusogBusogfokusområde

Recent Searches

sumayausopagtangoprocessaffecthatetechnologykahoyfionamakinangkangitanpresentmaghihintaymagtatanimumarawmagalinginalagaanbingimanoodmaka-yolintanewspapersnagawangnapadpadgutomsafenaghuhumindigcomofluidityidolbumangonlumiwagkuwentomaliligodurimanagerpapaanoibinilinagpasamadakilangpaglalayagkaysarapkakuwentuhankwartokinumutanmaiingaypagsusulitsinisiradumalomagulayawmasungitmaghapongmandirigmangbalotibinentaparinaglalakadnakapagngangalitnagtutulaknagtrabahopulang-pulanabalitaanlumalakimagkakagustohumiwalaynapakagagandapaglisannagmamadalifilmvirksomhederdeliciosacrucialtumutubonagmistulanginsektongmanghikayatkissnananalongfitnesspinagawanapasigawkumidlatmanahimikkumirotthanksgivinglumilipadumakbayabundantepaulit-ulitwriting,paninigaskasamaangkabiyaknamuhaypinangalanangbarcelonaligayasabongtumindigbarrerassumasayawlilikoninaarabiaeconomichinanapmakausappatiencehastaminamasdanenergybagongsandalingdrewbusyteachermatapangbrasoorganizeforståkasalgranadaadoptedalaalafittagalognoonpitumpongbatokbusloshopeekapevehiclessinkhitikpagbahingsumamatrafficiskokabibilaborpierneversofaimpitcigaretteplaysbumabatvspasanoncesparknaritoitonakatiraperoforevernapabeforeumupokumitanagpaalamumisipgirlnapakahabastage300mukahusureroidinidiktainabutantextoanongcomputersdulltatanggapinmasyadongsiopaomaestraiwananparinviolenceexistvelstandnaghuhukaynatanongbilugangnakakapagpatibayhinogpag-indakskirtnaglakadmasayahinmatapobrengpumapaligidpagkahapobloggers,nanlilimahidmanlalakbaymalulungkot