Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "expectations"

1. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

2. It is important to have clear goals and expectations in the workplace.

3. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

4. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

5. Unrealistic expectations can contribute to feelings of frustration and disappointment.

6. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

Random Sentences

1. Pulau Bintan di Kepulauan Riau adalah tempat wisata yang menawarkan pantai yang indah dan resor mewah.

2. The concept of money has been around for thousands of years and has evolved over time.

3. Kucing di Indonesia diberi makanan yang bervariasi, seperti makanan kering dan basah, atau makanan yang dibuat sendiri oleh pemiliknya.

4. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

5. She has completed her PhD.

6. Kapag ang puno ay matanda na, sa bunga mo makikilala.

7. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

8. Les travailleurs peuvent être contraints de travailler à distance en raison de la pandémie COVID-19.

9. A lot of traffic on the highway delayed our trip.

10. Buksan ang puso at isipan.

11. Me encanta el aroma fresco de las hierbas recién cortadas.

12. Sa muling pagkikita!

13. Lumiwanag ang aking puso sa simpleng "salamat."

14. They are often served with a side of toast, hash browns, or fresh greens.

15. Tuluy-tuloy niyang tinungo ang hagdan.

16. Les patients sont souvent mis sous traitement médicamenteux pendant leur hospitalisation.

17. Lagi na lang lasing si tatay.

18. Kahit mahirap ang buhay noon, nagsumikap si Carlos Yulo upang maabot ang kanyang mga pangarap.

19. Ang paglapastangan sa mga pampublikong lingkod ay dapat maparusahan nang naaayon sa batas.

20. Pasensya na, hindi kita maalala.

21. Naging tradisyon sa aming barangay ang nagiigib ng tubig para sa binyag ng mga sanggol.

22. Sa bawat bagong taon, may ritwal silang ginagawa upang magdala ng suwerte at kasaganaan sa buong pamilya.

23. Nakakatakot ang paniki sa gabi.

24. Ang sugal ay maaaring magdulot ng labis na stress, pagkabalisa, at pagkabahala sa mga manlalaro.

25. He does not break traffic rules.

26. Les mathématiques sont une discipline essentielle pour la science.

27. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

28. The internet, in particular, has had a profound impact on society, connecting people from all over the world and facilitating the sharing of information and ideas

29. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

30. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

31. Ang pag-asa ay nagbibigay ng mga solusyon sa mga suliranin sa buhay sa tulong ng pananalig sa Diyos.

32. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

33. Nanghiram ako ng bicycle para sa isang bike race.

34. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

35. Al que madruga, Dios lo ayuda.

36. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

37. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

38. In the early days, telephones were connected to a central switchboard, which connected calls manually

39. Maganda ang kulay ng mga puno sa panahon

40. Humihingal at nakangangang napapikit siya.

41. An omelette is a dish made from beaten eggs cooked in a pan.

42. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

43. Dahil sa kanyang natatanging kakayanan, naging tanyag ang bata sa iba't ibang lupalop.

44. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

45. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

46. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

47. Hindi ko naabutan ang dakong huli ng pagbubukas ng tindahan.

48. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

49. Hindi dapat natin balewalain ang mga taong nasa paligid natin, datapapwat ay may mga pagkakataon na hindi natin sila napapansin.

50. Gabi na natapos ang prusisyon.

Recent Searches

expectationsitemscontentmultoandycosechaspinatutunayannasabikinikitalumipaspagpapakalatotherspresleydoktoradvancedkawalaniba-ibangsapagkatnyakaminghopepreviouslykapallindolmangnitongsalatlaganapstreamingpinipilitnapakahangasalu-salopinakamahalagangtechnologiespare-parehoikinakagalitnagmamaktolkinatatakutankommunikerertiktok,i-rechargenagpagupitminamahalnavigationmagkakailaalas-diyespagkakakawiteconomypinakamahabaintensidadtumakasnakataaspagdudugopagsusulitmadungismakalapitalapaapcompanysugatangmarketing:kadalasibinaonpinisilfollowedincitamenternaabotmakapasaeleksyonopportunitybihasasumasakayestatebobototinapaykumustabisikletabalakpagsisisikuwartokingdomsundaebritishlagunacoloreuphoric1929hmmmmsumagotbingotoothbrushmaskminuto1940lutolupangritwalleytepootmallconnectingdaantenfacebookdatiipagbilinangyarimatabalackbelievedbruceproblemahalagaeyeyangtabimariangfuncionarmarahilmastermarahasprovidednegativedancehimigmanuksomantikamanakboputahemanagersyncexplainberkeleypakibigaygapmamulotmamitasmamalasmalisanmalimitmalikotnagsidalomalihismalawakmalamigmakulitmakisigmahirapmahigitmahalinmahabolmagtakamagtagomagnifymatangosmaglarobiocombustiblespostmaglabamagkanomagisipsabermasasalubongmarchantkuwartongelevatormagdaanherramientasmagbasamagbagomagasinmagandamagamotnakikini-kinitamagalitsupplyobtenernasasaktanmariankatipunanmag-isagrahambook:mag-inamadulasmadamotnamilipitmadalasmabagalmababawmaaringlupaloplungsodlungkutlungkotlumusoblumuhodpumansinlumisanmedmananaig