Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "expectations"

1. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

2. It is important to have clear goals and expectations in the workplace.

3. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

4. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

5. Unrealistic expectations can contribute to feelings of frustration and disappointment.

6. Women's relationships with their bodies have been shaped by societal expectations and cultural norms.

Random Sentences

1. Uuwi na ako, bulong niya sa sarili.

2. The birds are chirping outside.

3. Laughter is the best medicine.

4. Maputla ang kulay ng kanyang mukha ay aywan ba niya at pati siya ay tila pinanawan ng lakas.

5. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

6. Online business: You can start your own online business, such as dropshipping, e-commerce, or software development

7. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

8. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

9. Seguir nuestra conciencia puede ser difícil, pero nos ayuda a mantenernos fieles a nuestros valores y principios.

10. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

11. Dun na nga raw pala tayo dumeretso sabi ni Tita Andrea.

12. Yep, basta lang ibibigay mo sakin ang araw mo ngayon.

13. Nous avons prévu une lune de miel en Italie.

14. Ako ay nanatili sa iyong pagkatao subalit nagpadala ka mga pagsubok.

15. Nagka-cutting classes ako kanina dahil biglaang nagkasakit ako.

16. Eating small, healthy meals regularly throughout the day can help maintain stable energy levels.

17. The widespread use of the telephone has had a profound impact on society

18. Ano ang ginawa ni Trina noong Pebrero?

19. Naging napakaganda ng telang hinabi ng matanda.

20. El maíz necesita mucha agua para crecer y producir una buena cosecha

21. Before the advent of television, people had to rely on radio, newspapers, and magazines for their news and entertainment

22. The sun does not rise in the west.

23. Magandang umaga po. ani Maico.

24. She reads books in her free time.

25. E ano kung maitim? isasagot niya.

26. Upang hindi makalimot, laging may sticky notes ang malilimutin na si Bea.

27. Natapakan ako ni Juliet habang sumasayaw.

28. The team is working together smoothly, and so far so good.

29. Marahil ay maaga kang dapat umalis upang makarating sa pupuntahan mo sa oras.

30. Maglalaro nang maglalaro.

31. Ngumiti ako saka humalik sa mga labi niya.

32. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

33. Disente tignan ang kulay puti.

34. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

35. Hello love birds! bati ko sa kanila nang makalapit ako.

36. Anong pangalan ng lugar na ito?

37. You're stronger than this, pull yourself together and fight through the tough times.

38. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

39. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

40. Vivir en armonía con nuestra conciencia nos permite tener relaciones más saludables con los demás.

41. Rodeo Drive in Beverly Hills is a world-famous shopping destination known for its luxury boutiques and high-end fashion.

42. No puedo preocuparme por lo que pueda pasar en el futuro, solo puedo confiar en que "que sera, sera."

43. Tumango lang ako at ngumiwi, Oo eh, hindi kasi ako sanay.

44. Siyang pagdating ni Roque na agad ding tumalon sa ilog upang iligtas ang mga anak.

45.

46. Emphasis can be used to create a sense of drama or suspense.

47. Limitations can be cultural or societal, such as gender roles or stereotypes.

48. Ang laman ay malasutla at matamis.

49. Wedding planning can be a stressful but exciting time for the couple and their families.

50. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

Recent Searches

ochandoresponsibleexpectationsplatformsdevicesoftebumotosinagotinspirecomunicanhumansselebrasyontumiraattacknagpapanggapaddingmapmakapilingcuandoprogramabasaenvironmentmitigateevolvecharitablewaitsystemanihinumimikeksperimenteringisinamatungkolmatagalturismohagdanmagpapalitpaligidhirapitemshabakayafatpumatolbowlmaibanapasumugodseryosoumuuwijagiyabarcelonaeasierpampagandaalaalaminatamistaong-bayangalaanmatagumpayaspirationnanditostudiedgenekinumutanmasamangabacapitalistikinamatayfigurasbaiteventspuedenkomedorinatakeyarieeeehhhhpag-iwanemnerspecialwalongdikyamkutsaritangmotorworkshopundasnabiglaconstantlysalitangmakikipaglaromagpakasalmartespinatirapananakitasiaeditalimentohistoriaroofstocktrapikpinyangayonsumusulatshortpagka-maktolbanlagcalciumikinasasabikmagka-apomayamayaamericanusolutonakakarinignakahigangmatamisfonosinaabotibahagihealthierwishingsinuotkungsay,lalimconsistpinakamasayaimagingnapapikititinagopagkaganda-gandatelephonereservedsaritasinebabaingbabepinaghaloincreasedmakikinignatapakanbusyanghopepalengkesasamalangsampungpaderitinulospaghihirapawaynakakaanimiikutanmaligocrushalintuntuninpayopintosorpresamesasumakayagilaconvertidasunoma-buhayexportoutlinessolidifyemphasizednagtitiisavanceredemainitanghelboksingbusilakaguamapa,kuwebapunong-kahoyeitherbosesechavepanahonanitodispositivoscebunagbibigayknowshinahaplostatlongnagbantaywristpalamutimasakitdaminowtirahantinigilanmasaksihannakagalawconocidosbilanggo