Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "ball"

1. Aray! nagcurve ball sya sa sakit sa sahig.

2. Football players must have good ball control, as well as strong kicking and passing skills.

3. Haha! Bakit masama bang makidalo sa ball ng ibang school?

4. Players move the ball by dribbling, passing, or shooting it towards the basket.

5. Players move the ball by kicking it and passing it to teammates.

6. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

7. The momentum of the ball was enough to break the window.

8. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

9. The objective of football is to score goals by kicking the ball into the opposing team's net.

10. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

Random Sentences

1. Nag-usap kami kamakalawa ng tanghali.

2. Ikaw ang dumukot ng pitaka ko, ano? Huwag kang magkakaila!

3. Maghapon nang nag computer ang kanyang anak.

4. Ang pag-aalala sa kapakanan ng iba ay isa sa mga pangunahing sanhi ng pangamba.

5. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

6. They plant vegetables in the garden.

7. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

8. Oh sige na nga sabi mo eh. hehe.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

10. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

11. Don't worry about making it perfect at this stage - just get your ideas down on paper

12. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

13. Taga-Ochando, New Washington ako.

14. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

15. Gusto rin nilang patunayan kung siya nga ay magaling tulad ng napabalita.

16. La realidad es que todos cometemos errores, pero debemos aprender de ellos.

17. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

18. Kailan niyo naman balak magpakasal?

19. Seeing a long-lost friend or family member can create a sense of euphoria and happiness.

20. Sa pag-ibig, kahit gaano pa ito kalakas, kailangan pa rin ng respeto.

21. Napaluha si Aling Pising nang makita niya ang bunga nito.

22. Our relationship is going strong, and so far so good.

23. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

24. Les personnes ayant des motivations différentes peuvent avoir des approches différentes de la réussite.

25. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

26. Nakaramdam siya ng pagkainis.

27. Menciptakan keseimbangan antara pekerjaan, waktu luang, dan hubungan sosial membantu meningkatkan kebahagiaan.

28. Ngunit kailangang lumakad na siya.

29. Nakatingin silang lahat sa amin, Sabay kayong maliligo?!?!

30. Habang maliit pa ang bata ay itinuro na ng mag-asawa kung paano ang humabi.

31. Inflation kann dazu führen, dass Unternehmen Schwierigkeiten haben, Kredite zu erhalten.

32. En España, el Día de San Valentín se celebra de manera similar al resto del mundo.

33. Iyong kulay itim na bag ang bag ko.

34. Facebook has acquired other popular platforms, such as Instagram and WhatsApp, expanding its reach in the social media landscape.

35. Ang mga mamamahayag ay nagsusulat ng mga balita para sa pampublikong impormasyon.

36. The bird sings a beautiful melody.

37. Naglalaway ang mga tao sa pila habang nag-aabang sa paboritong fast food chain.

38. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

39. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

40. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

41. Ang rebolusyon ang tumapos sa pananakop ng mga kastila.

42. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

43. Los remedios naturales, como el té de jengibre y la miel, también pueden ayudar a aliviar la tos.

44. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

45. Limitations can be perceived or real, and they can vary from person to person.

46. Saan-saan kayo pumunta noong summer?

47. Einstein's brain was preserved for scientific study after his death in 1955.

48. The pretty lady in the movie stole the protagonist's heart.

49. Instagram offers insights and analytics for users with business accounts, providing data on post performance and audience demographics.

50. Ang mga karapatan ng mga anak-pawis ay kailangan ipagtanggol at ipaglaban.

Similar Words

basketballCaraballo

Recent Searches

ballunconventionallinawmagtatanimpedei-marksacrificemagpakaramimabaitnapakatalinopasensiyakinabubuhayteleponosang-ayonnagsisipag-uwianpaghabamahabolhorsematulunginlabassoonbandaginhawaanotherumokaytiiswalisnalasingnunokumustamataraybukodcultureschristmaslaamangestatenawalaminamadaliibinaonpagpapatubotinikganunsundhedspleje,nagtinginantaonhimselfsitawnagtataeinstrumentalprocessasultipidreynakamatiskamustamamanhikaninisnapakahangafilipinatravelercountryhumayofederaliniindahumigatulisanleksiyonricobaticonclusion,maarimagbibiladna-fundhuwebesmarsoataquesunahinnakakatulongintindihinincreasedpumulotrespektivenagplaytanyagdepartmentpitokikitawaterbiologipressnagtitindatoodahankaramihanpamannagpapaitimdesarrollaronmakingculpritmagkaibangangallagaslassuriininirapanmarketingmakalaglag-pantyhumanoresultstoryinatakemagsi-skiingpalaisipankisapmatakuripotginoongnagbabalanaglahonakatinginglugarcomunicarsebilisikatlongmaratingmagpagupitencuestasumibigmagbaliknanonooddisposalableinlovepasinghaltoolleftutak-biyaisamaevolvenglalabatumawamaglabapasigawestasyonsinabisugatangeksambasketballwouldrememberkumakapalpalitanchefsalatsumpatumambadpilaakongsandalibinatagumawasumunodgruposakristandoktoreroplanotilaawitinitaasmagpapalitpamagatfutureresorteitheripapaputolhigaanangkanniyogmasarapkayamamayaritohagdantahimiksayagayunmannatinnungwaringnakagagamoteffectsbridenamumulotpebrerolimitmakuhangvedvarendecigarettesmawalagiverrebolusyonkaraoke