Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "1950s"

1. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

2. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

3. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

4. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

5. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

Random Sentences

1. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

2. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

3. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

4. Dumating na ang araw ng pasukan.

5. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

6. They are not building a sandcastle on the beach this summer.

7. Magkano ang tiket papuntang Calamba?

8. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

9. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

10. Lights the traveler in the dark.

11. Ang bahay ni Lola ay palaging mabango dahil sa mga bulaklak na nasa hardin.

12. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

13.

14. Dapat natin itong ipagtanggol.

15. All these years, I have been discovering who I am and who I want to be.

16. He sought to strengthen border security and pushed for the construction of a border wall between the United States and Mexico.

17. Es freut mich, Sie kennenzulernen. - Nice to meet you.

18. Congrats Beast! Proud girlfriend here! natatawang sabi ko.

19. He does not waste food.

20. Seek feedback, it will help you to improve your manuscript

21. At forfølge vores drømme kan kræve mod og beslutsomhed.

22. The credit check for the apartment rental revealed no red flags.

23. "Dogs are like potato chips, you can't have just one."

24. Ang poot ay parang apoy na unti-unting umaalab sa aking loob.

25. Magdamagan ang trabaho nila sa call center.

26. Tumindig ang pulis.

27. Hindi malaman kung saan nagsuot.

28. The authorities were determined to find the culprit responsible for the environmental damage.

29. Cars, airplanes, and trains have made it possible for people to travel great distances in a relatively short amount of time

30. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

31. Pakibigay ng respeto sa mga matatanda dahil sila ang unang nagtaguyod ng ating komunidad.

32. Sa panahon ng tag-ulan, naglipana ang mga lamok sa amin.

33. Jacky! napalingon ako ng marinig ko ang boses ni Aya.

34. Los héroes pueden ser aquellos que defienden los derechos humanos y luchan contra la opresión.

35. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

36. Binili ni Rita ang damit sa tindahan.

37. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

38. Namnamin natin ang huling gabi ng ating paglalakbay.

39. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

40. Walang pagtutol sa mga mata ng mga ito.

41. The sunset view from the beach was absolutely breathtaking.

42. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

43. Humihingal na rin siya, humahagok.

44. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

45. Samantala sa trabaho, patuloy siyang nagpapakasipag at nagsusumikap para sa kanyang pamilya.

46. Protecting the environment involves balancing the needs of people and the planet.

47. Ang mahal pala ng iPhone, sobra!

48. Omelettes are a popular choice for those following a low-carb or high-protein diet.

49. Meal planning and preparation in advance can help maintain a healthy diet.

50. Emphasis can help to ensure that a message is received and understood by the intended audience.

Recent Searches

1950selectoralkumbentovetodibarestauranticonscharismaticmataposaddictioniigibpotentialrelevantindividualsanypagguhitpaketebinatilyotilimakinanglagunakasalananmaingatmatigasdeletingnapatinginbumotoangkanmulighedernatapostarcilachooseailmentsparicasadahannakaupokamatisbienmagdamagpuntacongressmaramitransparentipapainitpersonsreddecisionsdevicesloveitinaaspangkattabingdagatamingnasilawnangangahoylalawiganvibrateamerikaumiibigcanmakikitulognamataynegrosbagamattinayngunitimpactgraphiclangkaysignificanttindigdiseasesunotinitindanaupowalangpalabuy-laboybankcomputermatandang-matandatinulungansmokingkababayangtinungokongmelvintusongsystematisktissueinitlightsflightpresentatitigilmamitastopicmahihirapmalalimbayangagadpagtutolkuwadernoamazonmaligayamatatagnagagandahanpoliticalpinag-usapannakapangasawapapapuntakomunikasyonnagngangalangnagliliwanaggratificante,pinagtagpocuriouscultivonagkitalayawmagkahawakkakuwentuhanwalkie-talkienakakitapagdiriwangpagkakatayopagkakatuwaanpalipat-lipatmakinignakakapamasyalkategori,maipantawid-gutomenfermedades,magsasalitamuranginvestkawili-wilikumembut-kembotaraw-nakikini-kinitaprocessgeneratedneedsvisualexisttwo-partyilingbetweenanak-pawisdifferentexplainlibrospreadbroadcastinglumabassimplengeveryevilslavebadingparatingipinagbibiligasolinaevencouldclientesfigureplanhighmobiledownspeechchefstandcleartuwang-tuwaakongshareaideksampracticadopinalakingbeennagawashenaismayabongreadipinikitmahalagakinaiinisanpanahontsinelasimportantedumapacomputere,paki-translatenapakabangonagtutulungantumubo