Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "1950s"

1. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

2. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

3. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

4. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

5. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

Random Sentences

1. Napapagod ako sa bigat ng poot na umaabot sa aking kalooban.

2. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

3. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

4. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

5. El concierto de la orquesta sinfónica fue una experiencia sublime para los asistentes.

6. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

7. Ang pagtulong sa iba ay isang halimbawa ng kabutihang-loob na pinagsisikapan ng marami na isabuhay araw-araw.

8. The United States has a system of government based on the principles of democracy and constitutionalism.

9. Omelettes are a popular choice for those following a low-carb or high-protein diet.

10. Mababa ang tingin niya sa sarili kahit marami siyang kakayahan.

11. Ang daming bawal sa mundo.

12. The Great Wall of China is an impressive wonder of engineering and history.

13. Paki-drawing mo naman ako ng isang magandang larawan.

14. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

15. The weather today is absolutely perfect for a picnic.

16. Gaano katagal ho kung sasakay ako ng dyipni?

17. May lagnat, sipon at ubo si Maria.

18. Es importante reconocer los derechos y la dignidad de todas las personas, incluidas las personas pobres.

19. Kapag nagkakaroon ng sakuna, ang mga volunteer ay nagiigib ng tubig para sa mga apektadong pamilya.

20. Inirekumenda ng guro na magsagawa kami ng mga field trip upang mas mapalawak ang aming kaalaman.

21. Nakangiti sya habang nakatayo ako at nagtataka.

22. Saan ako nag-aaral ng kindergarten?

23. Bukas ay magpapagupit na ako ng buhok.

24. La agricultura sostenible es una práctica importante para preservar la tierra y el medio ambiente.

25. Di Indonesia, pemerintah mendorong pembinaan nilai-nilai keagamaan yang inklusif dan menggalakkan semangat gotong royong berbasis agama.

26. Cuídate mucho en el camino, maneja con precaución y no te distraigas.

27. Si Anna ay maganda.

28. Makikita mo, maganda talaga ang lugar.

29. Malapit na matapos ang kanyang termino sa pagka senador.

30. Kadarating mo pa lamang, Ogor, nais niyang itutol.

31. Drømme og håb kan drive os fremad i livet.

32. Nakakaanim na karga na si Impen.

33. El arte abstracto tiene una simplicidad sublime que pocos pueden entender.

34. Hintayin mo ko.. Kahit anong mangyari hintayin mo ko..

35. Sa panahon ngayon, maraming taong nagfofocus sa kababawan ng kanilang buhay kaysa sa kabuluhan.

36. El cilantro es una hierba muy aromática que se utiliza en platos de la cocina mexicana.

37. You're not being direct. Stop beating around the bush and just say it.

38. Ang taong lulong sa droga ay parang nasasakal na kaluluwa na patuloy na hinahanap ang paraan para lumaya.

39. La creatividad nos permite expresarnos de manera única y personal.

40. Bis bald! - See you soon!

41. Nationalism can also lead to a sense of resentment and hostility towards outsiders.

42. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

43. Hayaan na lang daw na mapagod ang mga mababangis na hayop at ibon sa pakikipaglaban basta sa kampo ng panalo siya sasama; hagikgik nito.

44. Kapag bukas palad ka sa mga taong hindi mo pa nakikilala, mas maraming taong pwedeng maging kaibigan mo.

45. Sa pagtitipon ng mga lider ng kompanya, ibinahagi nila ang kanilang mga mungkahi upang mapaunlad ang negosyo.

46. There are a lot of books on the shelf that I want to read.

47. Maraming mga uri ng droga, tulad ng marijuana, cocaine, heroin, at methamphetamine.

48. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

49. El momento del nacimiento marca el inicio de una nueva etapa en la vida de los padres.

50. Kinagalitan si Bereti at pinauwi ngunit ayaw sumunod ng bata.

Recent Searches

jenalegacy1950sninongpuwedemanghulikanannakainangfitnilulonokayaabotvalleymusttanodniligawanpaghinginakatingingmansanaskikosignpumatolpabalangopohinigitabalaplacedalawownbatopropensoelitelayaslosslinggoadverseomelettearbejdersupremekapeeuphoricupogenerabaknowmenupackagingbroadcastscountlessallowedrepresentedroberthalosmaalogpagbahingso-calledprocesofertilizermatchingoverallmisusedhamakdilimisugaharingnilinisbalingbusyangpakainsoonjackynagreplylabingbarriersmeetdolyarprobablementemurangkalanwidespreadpay18thyesrecentwouldipihitcreationgumagalaw-galawspeedthoughtsalerawclienteandrenakakitaulitsmokingservicesinfusionesipinagbabawalmaibigayconvey,pagtatanimiikutanpanonoodalmacenarhumpaypanunuksobihirakaniyanakainvelfungerendemerchandiseorganizepagkagalitnahulaanfurtherpingganmalakaschildrenkinatatalungkuangarghkitastrengthgameinterestlumalangoysnobmagkakaanaknapaluhanagmamaktolnakapagreklamoskillyonrelevanteskuwelahanbiocombustiblesanak-pawissang-ayonespecializadasmagtataasmagtiwalaphilanthropytatayopagsisisinagbantaynakatuonsasakaymiyerkulesisinuottungkodnangyarigiyeramangyarisanggoltaxipagpalitmaskinermanakboguerrerokarapatangnewsestadosindependentlymalamignoo11pmtwitchbalancesinvestautomationdelegatedcongratsbigongcigaretteadverselyitaasmaskaraleukemiarelopopcornespigasbubongbigelecttripminutemaglalakadpasangnagsagawanapakagagandaluluwasagam-agamnagsisipag-uwiannakakapamasyalkapamilyakikitanabigkasnagkapilatuusapan