Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "bunga ng pandemya sa turismo ng bansa"

1. Ang aking kamalayan sa kultura at tradisyon ng aking bansa ay nagpapalalim sa aking pag-unawa sa aking mga ninuno.

2. Ang ASEAN Summit ay dinaluhan ng mga pangulo ng iba't ibang bansa.

3. Ang bansa ay dapat lagi nating isipin, hindi lamang ang ating sariling interes.

4. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

5. Ang bunga ng kakaibang halaman at tila ba kamay na nag-iimbita.

6. Ang digmaan ay maaaring magdulot ng pagbabago sa pamamahala ng isang bansa.

7. Ang digmaan ay maaaring magdulot ng pagbabago sa relasyon ng mga bansa sa isa't isa.

8. Ang India ay napakalaking bansa.

9. Ang kabayanihan ni Rizal ay patuloy na pinararangalan sa pamamagitan ng pagdiriwang ng kanyang kaarawan at mga aktibidad sa buong bansa.

10. Ang kahirapan ay isang laganap na suliranin sa ating bansa.

11. Ang manlalakbay ay naglakbay upang lumibot sa iba't ibang bansa at masaksihan ang iba't ibang kultura.

12. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

13. Ang mga bunga ay nagkaroon ng malaki at maraming tinik na katulad ng rimas.

14. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

15. Ang mga sundalo nagsisilbi sa kanilang bansa upang protektahan ang kanilang kalayaan.

16. Ang pagkakaroon ng malubhang sakuna ay binulabog ang buong bansa.

17. Ang paglabas ng impormasyon tungkol sa isang malaking skandalo ay binulabog ang buong bansa.

18. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

19. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

20. Ang puno ng mangga sa bakuran namin ay hitik sa malalaking bunga ngayong tag-init.

21. Ang rebolusyon ay bunga ng pagkamulat ng mga Pilipino kontra kastila.

22. Ang talambuhay ni Gregorio del Pilar ay nagpapakita ng kanyang katapangan sa laban para sa kalayaan ng bansa.

23. Araw-araw na bumalik ang prinsesa sa kagubatan hanggang ang bulaklak ay napalitang ng bunga.

24. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

25. Bunga ng globalisasyon ang pag-unlad ng maraming industriya sa iba't-ibang bansa.

26. Dahil sa globalisasyon, lubos na umangat ang teknolohiya ng maraming bansa.

27. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

28. Dahil sa maayos na pamamahala, yumabong ang ekonomiya ng bansa.

29. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

30. Dahil sa sobrang ganda ng lugar, nahuhumaling ako sa pagba-vacation sa ibang bansa.

31. Hindi dapat nakatutok tayo sa mga kababawan ng buhay, kundi sa kabutihan ng ating kapwa at ng ating bansa.

32. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

33. Hitik na hitik sa bunga ang nasabing puno.

34. Inakyat ng bata ang puno at tinikman ang bunga.

35. Isang araw, tinikman ni Datu Duri ang isang hinog na bunga.

36. Isang binata ang napadaan at tinangkang kumain ng bunga ng puno.

37. Isang matandang lalaki naman ang tumikim sa bunga.

38. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

39. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

40. Kapag ang puno ay matanda na, sa bunga mo makikilala.

41. Kung ano ang puno, siya ang bunga.

42. Kung anong puno, siya ang bunga.

43. Laking pagkamangha ni Aling Rosa ng makita ang anyo ng bunga nito.

44. Maaaring magbago ang ekonomiya ng isang bansa dahil sa digmaan.

45. Maaaring magbago ang pulitika ng isang bansa dahil sa digmaan.

46. Madami ang nawalan ng trabaho dahil sa pandemya.

47. Malinis na bansa ang bansang Hapon.

48. Marahil ay nasa ibang bansa ang artista kaya't hindi mo siya maaaring makita sa personal.

49. Maraming bansa ang nagkakaisa upang magbigay ng tulong sa mga bansang naapektuhan ng digmaan.

50. Maraming bansa ang nagsimula ng digmaan dahil sa territorial disputes.

51. Maraming bayani ang nagbigay ng kanilang buhay upang makamit ang kalayaan ng bansa.

52. Maraming bayani ang nakalikha ng mga bagong teknolohiya at kaisipan na naging pundasyon ng progreso ng bansa.

53. Maraming paaralan at kalsada ang binigyan ng pangalan ni Mabini sa buong bansa.

54. Masyadong advanced ang teknolohiya ng bansang Japan kung ikukumpara sa ibang bansa.

55. May isa sa mga taong bayan ang nakakita nang isubo ng matanda ang bunga.

56. May mga dentista na nagbibigay ng serbisyo sa iba't ibang bansa para sa mga taong naghahanap ng magandang serbisyong dental.

57. Mukhang masarap ang prutas ngunit wala sino man ang mangahas na kumain nito sapagkat ang mga bunga ay lason.

58. Mula sa mga puno, naglipana ang mga bunga na naglalagay ng kulay sa kapaligiran.

59. Muli ay nakabawi ang ekonomiya ng Pilipinas matapos buksan ang turismo sa iba't ibang panig ng bansa.

60. Muling nagsimula ang rebolusyon sa pamamagitan ng magkaibang bansa.

61. Nagdaan ang maraming araw walang pumansin sa bunga ng puno hanggang sa ang mga ito ay mahinog.

62. Naghahanap ako ng mapa ng bansa para sa aking proyektong pang-geography.

63. Nagkaroon ako ng agaw-buhay na pagkakataon na makapag-aral sa ibang bansa.

64. Naglakbay siya sa ibang bansa upang hanapin ang hinugot niyang inspirasyon.

65. Nagtaka ang bata sapagkat walang nangyari sa babae; sa halip nakangiti nitong ibinigay ang prutas sa bata na siya namang tinikman din ang bunga.

66. Nakain na nito ang lasong bunga at unti-unti na itong nangingisay at bumubula ang bibig.

67. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

68. Nakatanggap ako ng inspirasyon sa mga kanta ng Bukas Palad sa panahon ng pandemya.

69. Nakatuwaang kainin ng mga bata ang bunga.

70. Nakita nilang ang balat ng bunga ay manipis at maliit ang buto.

71. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

72. Nang buksan ng mga tao ang ilang bunga ng punong-kahoy, kanilang nakitang ang balat ay makapal at ang buto ay malaki, ngunit ang laman nama'y matamis

73. Nang makita ng manlalakbay ang mga nakasabit na bunga ay bigla niyang naalala ang kanyang gutom at pumitas ng mga ito.

74. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

75. Napakaraming bunga ng punong ito.

76. Napaluha si Aling Pising nang makita niya ang bunga nito.

77. Napatunayan nilang lason ang mga bunga nang isang araw ay may napadpad na manlalakbay sa kanilang bayan.

78. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

79. Ngayon ang rambutan ay isa sa masasarap na prutas na makikita natin sa ating bansa.

80. Noon di'y nangalaglag ang lahat ng mga bunga ng punong-kahoy at natabunan ang katawan ni Sangkalan.

81. Noong una ayaw nilang paniwalaan ang bata ngunit di naglaon ay tinikman din nila ito at napag-alaman ngang matamis ang bunga.

82. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

83. Pumitas siya ng isang bunga at binuksan iyon.

84. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

85. Sa kanyang bakasyon, nagpasya siyang lumibot sa iba't ibang tourist spots ng bansa.

86. Sa kasalukuyan, marami ang may agam-agam sa kalagayan ng ating bansa sa gitna ng pandemya.

87. Sa loob ng ilang taon, yumabong ang industriya ng teknolohiya sa bansa.

88. Sa mga huling taon, yumabong ang turismo sa lugar na ito dahil sa mga magagandang tanawin.

89. Sa paglipat niya sa ibang bansa, kinailangan niyang mag-iwan ng mga kaibigan at pamilya.

90. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

91. Sa panahon ng pandemya, maraming tao ang naging nag-iisa dahil sa lockdown.

92. Sa panahon ng pandemya, mas marami ang nangangailangan ng bukas palad na pagtulong mula sa atin.

93. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

94. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

95. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa.

96. Sang-ayon ako na ang edukasyon ay isang mahalagang pundasyon sa pag-unlad ng isang bansa.

97. Sang-ayon ako na kailangan nating magkaroon ng malakas na liderato upang umunlad ang ating bansa.

98. Si Rizal ay kilala rin sa kanyang pagmamahal sa kanyang bansa at sa kanyang mga kababayan.

99. Tinikman nila ang hinog na bunga at natuwa sa tamis at sarap nito.

100. Tumamis at sumarap ang lasa ng bunga.

Random Sentences

1. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

2. Las escuelas promueven la inclusión y la diversidad entre los estudiantes.

3. Born in Tupelo, Mississippi in 1935, Presley grew up listening to gospel music, country, and blues

4. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

5. Maglalaba muna ako bago magpunta sa galaan.

6. The Statue of Liberty in New York is an iconic wonder symbolizing freedom and democracy.

7. Punta tayo sa park.

8. A series of earthquakes hit the region, causing widespread damage.

9. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

10. It is a common phenomenon experienced by individuals who feel a strong emotional pull towards parenthood and starting a family.

11. Ang taong may takot sa Diyos, ay hindi natatakot sa mga tao.

12. Practice makes perfect.

13. Tantangan dapat merangsang pertumbuhan pribadi dan mengubah perspektif kita tentang hidup.

14. Put all your eggs in one basket

15. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

16. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

17. Paglabas niya ng bahay, nabigla siya nang biglang umambon ng malakas.

18. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

19. Meskipun tantangan hidup tidak selalu mudah, mereka memberikan kesempatan untuk menjadi versi yang lebih baik dan lebih kuat dari diri kita sendiri.

20. Ang pag-ulan sa labas ay animo'y nagpapaligaya sa mga halaman sa hardin.

21. Ang lakas mo uminom wala ka naman ambag.

22. Nakatira si Nerissa sa Long Island.

23. Nasa Diyos ang awa, nasa tao ang gawa.

24. Nang mawalan ng preno ang sasakyan, aksidente niyang nabangga ang poste sa tabi ng kalsada.

25. Hockey players wear special equipment such as helmets, pads, and gloves to protect themselves from injury.

26. Sa mga hayop, ang hudyat ay maaaring gamitin sa pakikipag-ugnayan, tulad ng pagpapakita ng kilos ng buntot o ng mata.

27. Cada vez que cosechamos las frutas del jardín, hacemos una deliciosa mermelada.

28. Analog oscilloscopes use cathode ray tubes (CRTs) to display waveforms.

29. Inaamin ko na ang pagkakamali ko.

30. Ang mga punong kahoy ay nagbibigay ng magandang lilim sa takip-silim.

31. Yari sa kahoy ang sahig ng bahay ko.

32. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

33. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

34. The birds are chirping outside.

35. Las heridas superficiales pueden ser tratadas con agua y jabón.

36. May sinasabi ka ba? umiling ako sa tanong ni Kenji

37. The uncertainty of the future can cause anxiety and stress.

38. Itinali ng hari ang batang higante at pinakawalan ang mga taong nakakulong sa kuweba.

39. Stocks and bonds are generally more liquid than real estate or other alternative investments.

40. Sa kaibuturan ng kanyang puso, alam niya ang tama at mali.

41. Palibhasa ay may kakayahang makipag-usap sa ibang mga tao sa iba't-ibang antas ng kaalaman at pinag-aralan.

42. Minabuti nilang ilihim nila ito sa kanilang anak.

43. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng kasiyahan at kaganapan sa aking buhay.

44. Ang pangungutya ay hindi magbubunga ng maganda.

45. Dedication is what separates those who dream from those who turn their dreams into reality.

46. El invierno marca el final y el comienzo de un nuevo año, lleno de esperanzas y propósitos.

47. Ang bayanihan ay nagpapakita ng pagkakaisa at pagtutulungan sa pagharap sa mga hamon ng buhay.

48. Athena. nagulat siya at bigla niyang pinatay yung monitor.

49. I know I should have started studying earlier, but better late than never, right?

50. I am not exercising at the gym today.

Recent Searches

chartsdiettypesinformedhellorevolucionadotuloypagpalitprocesseshimutokfrogyumabongtsinatamaanpagluluksabaclarannakikihukaytmicahuwebespaki-chargeanakkongdalibabesdamiitukodoperahansusunduinreguleringeleksyonborntaposnutsbasketballreallysentenceclimanakasuotpalagingubodpakaininforskelcomputerpabalikamingatentonagtatakakinausapano-anoctricaskasuutanlutokauntipagkabuhaystudentculturesninyodotanahuluganumokayasignaturatessdapatmay-bahaycrosscitizensactortambayanniyanganghomespalakaheinamamsyaltinataluntonkunehotrabahopitongmanuscripttelebisyonkasaganaanprinsesaharapintinitindatumulongumaapawfurtinawagnilalangkalanbastasubject,nagpalutonagsasabingoscarpasiyentebillmarmaingkarunungankiloiikotmagdilimbakasyonkailanganmasayafriendsmalambingsumasambakinagagalakconvertingalassaidmaingatrosarioanak-pawiskaugnayanbusinessesunitednami-misshampasehehepanatagpaksanakaririmarimsubalitsalapinapagodmakapagsabiaplicacionespetspeechesagwadormakapalnariningestilostwomatiyakpassionsandaliflexiblemasayang-masayanapakaalatfratransmitskotsengrestawranhinagismanakbodadanapabook,pagodhinding-hindimatulunginrememberbihasainspirationsatisfactionkahirapansharingjannakontrahousemarahilsimbahanreserbasyonsweetmappag-aapuhapkungtayosiemprehamonprofoundhangindanzabethdraft:nahahalinhansponsorships,allergycuredmagdadapit-haponbustaosgayadedication,pagkapunopagbabantapetsangagessalatinnagdaanamoynagtaposscottishpamamagitankalikasanmanirahanbiglaan