Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "consist"

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. The charitable organization provides free medical services to remote communities.

2. Ang snob naman neto. Alam mo ba kung anong oras na?

3. Users can like, react, or share posts on Facebook to show their engagement and support.

4. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

5. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

6. My husband surprised me with a trip for my birthday, and I couldn't be happier.

7. The victim's testimony helped to identify the culprit in the assault case.

8. Elle adore les films d'horreur.

9. En ren samvittighed kan give os en følelse af ro og tilfredshed.

10. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

11. Nagsmile siya sa akin at ipinikit niya ulit yung mata niya.

12. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

13. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

14. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

15. Amazon's Kindle e-reader is a popular device for reading e-books.

16. Les enseignants peuvent utiliser des outils technologiques tels que les tableaux blancs interactifs et les ordinateurs portables pour améliorer l'expérience d'apprentissage des élèves.

17. One of the most significant areas of technological advancement in recent years has been in the field of communications

18. Sadyang nagulat ako sa kanyang biglaang pagbisita.

19. Busy pa ako sa pag-aaral.

20. Paki-drawing mo naman ako ng isang magandang larawan.

21. Nasa Canada si Trina sa Mayo.

22. Sa tuwing nadadapa ako, hindi ko mapigilang maglabas ng malalim na himutok.

23. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

24. The project was behind schedule, and therefore extra resources were allocated.

25. Candi Prambanan di Yogyakarta adalah candi Hindu terbesar di Indonesia dan merupakan situs warisan dunia UNESCO.

26. El actor hizo un comentario controversial que está llamando la atención de los medios.

27. Makikiraan po!

28. Matagal ko nang pinapaliwanag sa kanila ang mga dahilan kung bakit ako tumututol sa kanilang plano.

29. As your bright and tiny spark

30. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

31. At have en træningsmakker eller træningsgruppe kan hjælpe med at øge motivationen og fastholde en regelmæssig træningsrutine.

32. Sweetness can be balanced with other flavors to create a harmonious taste experience.

33. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

34. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

35. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

36. Estos dispositivos permiten a las personas comunicarse desde cualquier lugar, ya que se conectan a redes de telecomunicaciones y no requieren una línea física para funcionar

37. Ibig niyang maranasan ang mga bagay na kaiba sa kinalakihan.

38. La labradora de mi tía es muy inteligente y puede hacer trucos increíbles.

39. Ang pagkakaroon ng malalakas na ingay mula sa kapitbahay ay binulabog ang kapayapaan ng tahanan.

40. He was a pioneer in martial arts and fitness and his teachings are still relevant today

41. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

42. Danmark er kendt for at eksportere højteknologiske produkter og services til andre lande.

43. Marahil ay maaga kang dapat umalis upang makarating sa pupuntahan mo sa oras.

44. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

45. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

46. Pumunta ang pamilyang Garcia sa Pilipinas.

47. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

48. Makikita mo, maganda talaga ang lugar.

49. Gusto ko sana na malaman mo na pwede ba kitang mahalin?

50. He is driving to work.

Recent Searches

consistmaluwanginantokmakisigdeteriorateeuphoricdreamfar-reachingorderinbarohumanowowsorematchingbasahanvampirespostcardsaanbataysukatcollectionsdalawtuluy-tuloypangitilanconcernssciencenaritodrayberbruceoutexpeditedfreelancersparkbinigyangpag-uugalirichpumuntaipinanganaklimitmaputianimeksampinilingcrosseasyadditionallypupuntasincekingmakapilingaddingmemorythirdpaceformatcuandocontrolledmagbubungaqualitygenerabaprimerossheprinsipenatigilandapatkasingtigasakmapeterbalitangdadalhinmalakingbilliintayinihahatidibinigayaraw-ibibigaymaistorbohumampashumahabahospitalhomeworktulonghistoriahintayinhinintaynakakunot-noonghinandenhagikgikpagkainggumisinggumapanggumalinggumagawaninumanguitarraguidanceginawangginagawatumindignaggeologi,thingsgenerategayunmangayundingandahanfundrisefreedomsnakatindiglandlinegumagamitforskel,makatulognapagtantopaglapastanganfinishedfeedbackinhalebihirangfactoresdireksyongarbansostumatawadsilid-aralanfacemaskfacebookexpresanbinatoexperts,expandedestasyonespanyolentranceeleksyonelectionpampagandaeksaytedbibilhinjolibeeydelserdyosaninyongnagpa-photocopymagkikitaejecutareeeehhhhdumaramidiwatangnakahigangkinapanayammakangitimagpaniwalareserbasyonkasaganaandisensyodiseaseshealthierbarung-barongdetectedikinabubuhayikinatatakotvirksomheder,decreasewinedatapwatdamdamindalandandalagangcurtainspersonculturascontent,nanlalamigcongressimporhouseholdsaktibistanakapaligidcompletecommercepamumunokomedorcombinedincluirmagsasakaninanaisnakasakitmaglarocoinbasecardiganisinagotnatuwaenviarcoachingiginawadclientescharmingchambers