Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "consist"

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

2. Siempre me preocupo demasiado por las cosas, pero debería recordar que "que sera, sera."

3. The most famous professional football league is the English Premier League, followed by other major leagues in Europe and South America.

4. La música puede ser utilizada para transmitir emociones y mensajes.

5. Foreclosed properties may be sold with special financing options, such as low down payments or low interest rates.

6. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

7. The Petra archaeological site in Jordan is an extraordinary wonder carved into rock.

8. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

9. Don't give up - just hang in there a little longer.

10. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

11. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

12. Kapag nagluluto si Nanay, ang buong bahay ay napupuno ng mabangong amoy ng pagkain.

13. Ang lamig ng yelo.

14. Representatives can be found at various levels of government, such as local, regional, national, or international.

15. Masyadong mababaw ang tubig sa tabing-dagat.

16. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

17. Football is a popular team sport that is played all over the world.

18. Masama ang pakiramdam ko kagabi kaya ako ay biglaang nagpunta sa ospital.

19. Kucing di Indonesia juga dikenal dengan sebutan "meong" atau "ngomong" karena suaranya yang unik.

20. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

21. Nabasa niya ang isang libro at matapos niyang basahin, naglimot na agad siya sa mga pangunahing detalye ng kwento.

22. Mahalaga ang regular na pagsisipilyo at paggamit ng dental floss upang maiwasan ang mga sakit sa bibig.

23. Hugis katawan ng nakahigang babae ang bundok makiling.

24. Las heridas superficiales pueden ser tratadas con agua y jabón.

25. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

26. Sa balkonahe ng kanyang bahay sa Kawit, idineklara ang kalayaan ng Pilipinas.

27. Stuffed Toys, Mini-Helicopter, Walkie-Talkie, Crush Gear, Remote Controlled Cars, at higit sa lahat, ang Beyblade.

28. Ang pagkakaroon ng sapat na kaalaman at impormasyon ay nagpapawi ng mga agam-agam at kawalang-kasiguruhan.

29. Have we completed the project on time?

30. Malaya na ang ibon sa hawla.

31. Ang mga bayani ng kasaysayan ay dapat na itinuring at ipinagbunyi bilang mga pambansang tagapagtanggol at inspirasyon.

32. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

33. Nakakalasing pala ang wine pag napasobra.

34. Bukas ay magpapagupit na ako ng buhok.

35. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

36. Emphasis is the act of placing greater importance or focus on something.

37. Hiram na kasuotan ang ginamit niya para sa theme party.

38. I am not reading a book at this time.

39. Cutting corners might save time now, but it will cause problems down the line.

40. Ang produktong ito ay may mataas na kalidad, samakatuwid, marami ang bumibili nito.

41. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

42. They have been studying science for months.

43. Eine hohe Inflation kann das Wirtschaftswachstum verlangsamen oder stoppen.

44. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

45. Nationalism is a political ideology that emphasizes the importance of the nation-state.

46. Mayroong dalawang libro ang estudyante.

47. The fillings are added to the omelette while it is still cooking, either on top or folded inside.

48. He also believed that martial arts should be used for self-defense and not for violence or aggression

49. La música clásica tiene una belleza sublime que trasciende el tiempo.

50. Iniisip ko ang aking mga pangarap, datapwat alam kong ito ay magiging mahirap abutin.

Recent Searches

pinalutobusiness,consistgivenoosantocollectionstransmitsadicionalesmadurasbutihingsuccesssigepasangmamitripreservationburdenumiinitmentalcompartencoinbasepocajerryasinpakpakfireworkslasingeromessageipinalitexamplekapilingaddingmulingmediumfuturestructureilinguponfourstreamingfeedbackryanhinahanapeskuwelamasamanglendemocioneshumihingitalagangmarangalmagsusunuranphilosophyhalinglingtuyokasawiang-paladtsaafavorlalonagiisloweconomicnaglabavariousentrancematangumpayforståmeaningnapatinginbatokmarioloansgear1980rabereadersipinikitleomapaikotlikelyplaysstudentstiyakculturatabing-dagatoktubrepagkakapagsalitanahihiyangnakatulogbumibitiwmagkaibangnaghuhumindigmakapagsabiinvestingnagpepekenakikiadahan-dahankagandahanmakipag-barkadanaguguluhangnakapagsabigutompagngitifotosnagtuturorenombrenagmungkahihealthierkinikitareserbasyonnapapalibutannakagalaweskuwelahannagtitindamagkahawakpoliticalnagpapaniwalanagliliwanagsinaliksikairportkagipitangumawakumakantamagalanglalakileadersbagsakkapasyahanculturekumikilostatayogandahannakaraantemperaturabutikividenskabjingjingipinatawagnag-emailnakatuonumagawkanginamahulognapuyatpagkuwantabingtumiramauliniganyouthnakatitigpumilihimutokpagbibiropakukuluanapelyidotulisanmilyongtog,inaabottotoolagnatnavigationalas-dosevolucionadocountrytaximahabangnagbentamaghapontinikmanpanginoonpatakbongpaaralaniniresetalumiitnilaosgubatvictoriatandangmagselosmahabolmahalmalalakisinocombatirlas,kailanmanahhhhretirarmatangkaddisciplinmarinigagilapaglayasfollowednangingilidmatandangfollowingmakalingporgatolunconstitutional