Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "consist"

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

Random Sentences

1. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

2. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

3. He was already feeling sad, and then his pet passed away. That really added insult to injury.

4. Nahintakutan ang lahat at hindi magawang lumaban sa magbabagsik na tulisang-dagat.

5. Tomar decisiones basadas en nuestra conciencia puede ser difícil, pero a menudo es la mejor opción.

6. The zoo houses a variety of animals, including lions, elephants, and giraffes.

7. We need to optimize our website for mobile devices to improve user experience.

8. Ang kanyang bahay sa Kawit ay isa na ngayong pambansang dambana.

9. En España, la música tiene una rica historia y diversidad

10. Ang daming adik sa aming lugar.

11. Oo. Tatawagan ka daw niya pag nandyan na siya.

12. Hindi ba nagdaramdam ang nanay at tatay mo?

13. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

14. Disculpe; ¿me puede ayudar por favor?

15. Das Gewissen ist ein wichtiger Faktor bei der Entscheidungsfindung in schwierigen Situationen.

16. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

17. Hindi malinis ang mga tsinelas ni Lori.

18. Matapos ang matagal na relasyon, napagpasyahan niyang mag-iwan at mag-move on.

19.

20. Papunta na ako dyan.

21. AI algorithms can be supervised, unsupervised, or semi-supervised, depending on the level of human involvement in the training process.

22. Es ist wichtig, ehrlich zu sich selbst zu sein, um eine gute Gewissensentscheidung treffen zu können.

23. Ang mga tulay sa aming bayan ay tinutukoy bilang mga mayabong na likuran na may bulaklak at mga halaman.

24. Napatingin ako sa menu. Parang nagc-crave ako sa hotdog.

25. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

26. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

27. Nais naming makita ang mga balyena sa malapit na karagatan.

28. Me cuesta respirar. (I have difficulty breathing.)

29. Subalit kinabukasan, matapos isuga ang kalabaw ay bayawak naman ang napagtuunan ng pansin ng batang sutil.

30. Ang nagtutulungan, nagtatagumpay.

31. Apa yang bisa saya bantu? - How can I help you?

32. Tumindig ang pulis.

33. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

34. Maliit ang telebisyon ng ate ko.

35. Other parts of the world like Burma and Cuba also cultivated tobacco

36. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

37. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

38. Many people work to earn money to support themselves and their families.

39. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

40. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

41. La empresa está tratando de llamar la atención del público con su nuevo anuncio.

42. And dami ko na naman lalabhan.

43. Ang taong walang tiyaga, walang magtatagumpay.

44. Nag-aaral siya sa Seasite bawat araw.

45. We have been married for ten years.

46. Gracias por hacer posible este maravilloso momento.

47. Einstein's brain was preserved for scientific study after his death in 1955.

48. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

49. Naglinis kami ng bahay noong Linggo.

50. No pierdas la paciencia.

Recent Searches

consistwalngspareyoutube,seaganangbuhawinotdamitpiyanomatanggalitwalisfuryeffortsbilinkanatelangmorecolourgamesnucleartrippasangminuteulapstatingimpitstoplightbroadeducationalwayslumayasnagpadalatelevisedhomesusinglaranganuloentrytermamazonrobertandymanamis-namispinakamahalagangtumutubopaglalaitcultivapinag-aaralanmaliksipaghaharutantitatungkodataquespagtatanimleaderskulturinuulampagbatitasahinigitdurantenakarinigmagandapinalitanika-12matabangmukhalumbaywaribilugangmayochoiceexcusewordspaglalabadahiwasukatcruzfatalbranchesateerrors,ipongwithoutanungmahihirapvitaminssiniyasatmakapagsabihinimas-himassaritamahahanaynanahimiklumiwanagadvertising,nanghahapdipagkakatuwaangayunpamangiverisdamagpaliwanagmagkaibapagtiisannanghihinanapapatungoikinamataynag-aalangannecesariosinaliksikbagsakhalu-halonakuhasulyaptungawnag-aagawanmakapalrektanggulousuariomamalaspoorerpagsuboktahimikbangkanapapansinmagbakasyonnakisakaymantikanilaosiniresetanalangpaanobinge-watchinghahahamatandangkagabihinilasandwichnobodydisensyotumingalacynthiarobinhoodsahodvelfungerendehatinggabihihigitberetiwakasnakainmulabahanakatinginnaminmatikmanpalibhasatawaalmacenarbagongtiyanmayamanginventadodumilimpakisabihastabilanggodiseasessumimangotaraw-filmsalasanywheremalamangvetomagtipidmulighederyunbateryalagisinumanglikestwo-partyseniorsupilinapoymangecardestablishwalangleoaywanbitiwanburmaarghnakatawagmarsointerestbuwalmaaring