Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "pasya"

1. Ang pasya nang pagkapanalo ay sa tela ng matanda.

Random Sentences

1. Ako ay bumili ng lapis sa tindahan

2. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

3. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

4. Hindi magandang magpakita ng pagmamalabis sa pagkakain sa mga simpleng pagtitipon.

5. George Washington was the first president of the United States and served from 1789 to 1797.

6. Anong kailangan mo? pabalang kong tanong.

7. Sa kabila ng lahat ng pagsubok na dumadating sa atin, ang mga kanta ng Bukas Palad ay patuloy na nagbibigay ng pag-asa at liwanag.

8. Gambling kan have negative konsekvenser for en persons mentale og fysiske sundhed, samt deres relationer og økonomiske situation.

9. Ang daming pusa sa bahay nila Jocelyn.

10. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

11. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

12. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

13. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

14. Kailan nagtapos ng kolehiyo si Peter?

15. La esperanza y los sueños son las llaves para la felicidad y la realización personal. (Hope and dreams are the keys to happiness and personal fulfillment.)

16. Boboto ako sa darating na halalan.

17. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

18. The library has a variety of books to choose from, ranging from classics to modern literature.

19. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

20. Ang daming tao sa peryahan.

21. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

22. Ako si Rodona ang diwata ng budok na ito.

23. El agua potable es fundamental para mantenernos hidratados y saludables.

24. Selvstændige medarbejdere arbejder ofte på egen hånd.

25. The actress on the red carpet was a beautiful lady in a stunning gown.

26. Los días soleados de invierno pueden ser fríos pero hermosos, con un cielo azul brillante.

27. Ang lider ng samahan ay pinagpalaluan ng mga miyembro dahil sa kanyang integridad.

28. A través de la música, las personas expresan sus emociones, comparten sus historias y conectan con los demás

29. Wala siyang ginagawa kundi ang maglinis ng kanyang bakuran at diligin ang kanyang mga pananim.

30. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

31. Mon fiancé et moi avons choisi nos alliances ensemble.

32. Sa bawat pagkakataon na binibigyan tayo ng pagkakataon, dapat nating gamitin ito nang wasto, samakatuwid.

33. The French omelette is a classic version known for its smooth and silky texture.

34. The sports center offers a variety of activities, from swimming to tennis.

35. Ang sugal ay isang bisyong maaaring magdulot ng malaking pinsala sa buhay ng isang tao.

36. May bakante ho sa ikawalong palapag.

37. Weddings are typically celebrated with family and friends.

38. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

39.

40. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

41. Fathers can be strong role models, providing guidance and support to their children.

42. Las hierbas deshidratadas se pueden almacenar por más tiempo sin perder su sabor.

43. Puwedeng pautang, nanakawan kasi ako?

44. Gusting-gusto ng kanyang magtatapos na anak ang minatamis na garbansos.

45. Maya-maya, muling naupo at dumukot ng isang lapis at isang maliit na kuwaderno sa kanyang bulsa.

46. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

47. La paciencia es la clave para conseguir lo que deseamos.

48. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

49. Ang lolo at lola ko ay patay na.

50. Mengatasi tantangan hidup membutuhkan ketekunan, ketabahan, dan kemauan untuk beradaptasi.

Similar Words

nagpasyakapasyahanpasyalan

Recent Searches

bugtongpayresearch:pasyatools,boyetideasnaghuhumindiginferioresfollowing,dekorasyonnagpaalamnahawakantiniradornasasabihannagpapaigibnabalitaankumakalansinggeologi,nakabulagtangikinagagalaknagkakatipun-tiponlaylaymahinogmensaheairportpansamantalapanalanginpagkasabiculturepahahanapdiretsahangagaddiinibinigayfactoresnatatawamagpapigilpagkagisingasignaturamaintindihanmagandanglumindolpagbibirokulturisinusuottinuturonagsilapithahahamahabangtumamaisipanminahanampliabunutandealmahigitretirarasahanhatinggabikasaysayanatinmoodjaceipanlinisbroughtsubjecttuwangsukatwestpagkatnakinigbinibilinapapikitmariloubutidialledhinintaycocktailgamotdeteriorateloansingatannoodulottillcapitalsupremevehiclesiatfnoblebevaremalakikikocomputere,happenedelectoralgagsiglamarahilulinghomeworkpalagingabstainingcondotomarproveyanmulipakpakfistsitimtopic,bigdidleeilankararatingsabifeedbackhelloreadmaputiwouldipagtimplabroadnagginghelpfulconectanincludebehavioreffecterrors,increasestipinfinityexisteffectsnaniniwalaumiibiggiyerapangungutyamentalhinipan-hipankapatawarankumampikinuskospaghangaisinagotnapilitangcoughingkambingninongpanaymurangdelebellpasyalanlockdownposterlightstaga-hiroshimaeksamcountlessbowadaptabilityhigitibototuloynapatawadtinulak-tulaksegundogalitmeronkayamasasarapkasabaymaghilamosincidencetungkodkotsenapaiyakchadtumapospinakamagalinglumulusobochandoanimcomplicatedkumalmakababalaghangnagsasagotmusiciansnaglakadvillagemagtigilrawalbularyoforcesmami