Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "diseases"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

3. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

4. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

5. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

6. It has been found that by abstaining from smoking a person may be cured of many diseases

7. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

8. Viruses are small, infectious agents that can infect cells and cause diseases.

Random Sentences

1. Kailan po kayo may oras para sa sarili?

2. The Grand Canyon is a breathtaking wonder of nature in the United States.

3. Nagbabaga ang hangarin ng mga kabataan na magtagumpay sa kabila ng mga hamon.

4. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

5. La pimienta cayena es muy picante, no la uses en exceso.

6. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

7. Pinakain ni Fia ang aso ng dog treats.

8. Mayroon akong ibang mungkahi at ito ay ang dahilan kung bakit ako tumututol sa kanilang panukala.

9. Nagtatrabaho ako tuwing Martes.

10. Tila hindi niya iniinda ang sakit kahit halatang nasasaktan siya.

11. Saan mo dinala ang dinukot mo sa aling ito?

12. The politician tried to keep their running mate a secret, but someone in their campaign let the cat out of the bag to the press.

13. Nasaan ang Ochando, New Washington?

14. Isang bansang malaya ang Pilipinas.

15. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

16. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

17. Lazada's mobile app is popular among customers, with over 70 million downloads.

18. Don't worry about making it perfect at this stage - just get your ideas down on paper

19. Ang paglapastangan sa dignidad ng kapwa ay hindi dapat maging bahagi ng ating kultura.

20. They have studied English for five years.

21. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

22. Nanalo siya ng Palanca Award para sa panitikan

23. Ang pangalan ni Carlos Yulo ay patuloy na magiging simbolo ng tagumpay ng atletang Pilipino.

24. Representatives can be found at various levels of government, such as local, regional, national, or international.

25. Ang pinakamalapit na lugar na kanilang narating ay mababa pa rin ang altitude.

26. Aanhin ko 'to?! naiiritang tanong ko.

27. Maskiner er også en vigtig del af teknologi

28. Sa pagsasaayos ng aming barangay hall, nagkaroon kami ng malaking tagumpay dahil sa bayanihan ng mga residente.

29. Sa simbahan, napansin ng pari ang magalang na kilos ng mga bata sa misa.

30. The objective of hockey is to score goals by shooting the puck into the opposing team's net.

31. Other parts of the world like Burma and Cuba also cultivated tobacco

32. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

33. Nasa Canada si Trina sa Mayo.

34. Ang digmaan ay maaaring magdulot ng pagbabago sa relasyon ng mga bansa sa isa't isa.

35. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

36. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

37. Ang kanilang panaghoy ay tinugunan ng tulong mula sa mga taong may mabubuting puso.

38. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

39. Oh gosh. Inintay pa sya ng prince, what does it mean?

40. Research and analysis are important factors to consider when making investment decisions.

41. Nasi uduk adalah nasi yang dimasak dengan santan dan rempah-rempah, biasa disajikan dengan ayam goreng.

42. Nogle helte er kendte for deres modige handlinger under krig.

43. Kailan tayo puwedeng magkita ulit?

44. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

45. Itinago ko ang mga sulat para sa inyo.

46. I know I'm late, but better late than never, right?

47. Binabasa ng mga mag-aaral ang talambuhay ni Emilio Aguinaldo para mas maunawaan ang kasaysayan ng Pilipinas.

48. Good morning. tapos nag smile ako

49. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

50. The dog does not like to take baths.

Recent Searches

iwasandiseaseslearnbibigyanlasadespuesnotebooknevernicepanorelevantpatiuponnapakahusayleadinginteriormaskiactiondigitaltelangownbisigdebatesginanggabejackzfireworksschoolsperanggodlabingdontpaladnaputolwhethertamadsuedeeditcharmingflashpinangyarihanmakitangnagpapasasaobra-maestraestudyanteduwendepagtangisnicokapalakindagatsubject,wasakinternacionalmadalingkagipitanlumiitkanannagturobagamatsalitatrajelunasunconstitutionalsanbulalasumigibrightspropensogamotkisswalanakapamintanakulaykawili-wilikumukuhakumembut-kembotabstainingtinulak-tulakitinuringpoliticaleksaytedpagkalitoisasabadnawalangopgaver,hubad-barokinauupuantahananmaihaharapnagsilabasannaupodesisyonankinalakihanmagkasamanakapasokpakinabanganpinagmamasdankommunikerertumatawagusuariokakutisnangahasmanilbihaneksport,uwakkaramihannangyaripumikitmaynilahinahanapiyamotbuwenasdamdaminangelamatalimnakauslingmakangitipinoyfollowingagostosakenbibilhinpalitanmoneypanataganumanpauwiomfattendemaongmanualkuboatensyonmaingatmaalwangnasanperwisyodeletingmaatimmarilouteacherpinagkasundopamanbundokpaaralansuwaildalagangmarmaingsumasakitnogensindetakes1787sinagotpalapitwastoamerikalendingkatagalantransmitsconnectingplatosinipangnakasuotsakinbinibinisabihingtherapynyaasimbluesearchdiamondpocaflexiblewowpamanhikanpinalutoisugamesanghubademailumiinitbeintesamubiggestcoatmulsumugodipapahingaendipinaobstaclesgrabelockdownreportfriesinangstartedlutuinguide