Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "diseases"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

3. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

4. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

5. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

6. It has been found that by abstaining from smoking a person may be cured of many diseases

7. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

8. Viruses are small, infectious agents that can infect cells and cause diseases.

Random Sentences

1. Si Ana ay humanga sa disenyo ng saranggola ng kanyang kuya.

2. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

3. Mga guro sina G. Santos at Gng. Cruz.

4. Aling hiwa ng baboy ang gusto mo?

5. Si Apolinario Mabini ay kilalang bayani ng Pilipinas.

6. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

7. Tanging ina lang at kapatid niya ang kanyang kasama

8. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

9. Está claro que la evidencia respalda esta afirmación.

10. Malinis ang kuwarto ng mga magulang ko.

11. The victim's testimony helped to identify the culprit in the assault case.

12. Sampung minuto na lang bago mag-alas otso.

13. Kailan ipinanganak si Ligaya?

14. May bagong dokumentaryo na ginawa ukol kay Apolinario Mabini.

15. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

16. Les employeurs cherchent souvent des travailleurs expérimentés.

17. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

18. Nakahug lang siya sa akin, I can feel him..

19. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

20. El autorretrato es un género popular en la pintura.

21. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

22. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

23. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

24. Bawal ang maingay sa library.

25. Chumochos ka! Iba na pag inlove nageenglish na!

26. Nangagsipagkantahan kami sa karaoke bar.

27. Hindi niya inaasahan ang biglaang pagbisita ng kanyang kaibigan.

28. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

29. Fødslen kan føre til forskellige fysiske forandringer i kroppen, og genopretningstiden varierer fra person til person.

30. Ang aso ni Lito ay mataba.

31. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

32. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

33. Magsi-skiing ako sa buwan ng Enero.

34. The scientific community is constantly seeking to expand our understanding of the universe.

35. Natawa nanaman sya, Hindi, maganda sya.

36. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

37. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

38. The exhibit features a variety of artwork, from paintings to sculptures.

39. The athlete completed a series of intense workouts to prepare for the competition.

40. Presley's influence on American culture is undeniable

41. The hockey rink is divided into three zones, with each team playing offense and defense alternately.

42. Las serpientes son animales solitarios y, en su mayoría, evitan el contacto con los humanos.

43. Nagtitinda ang tindera ng prutas.

44. I discovered a new online game on a gaming website that I've been playing for hours.

45. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

46. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

47. Gustong pumunta ng anak sa Davao.

48. Naglaro ng bola si Juan sa bakuran kasama ang kanyang mga kaibigan.

49. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

50. Sustainable transportation options, such as public transit and electric vehicles, can help reduce carbon emissions and air pollution.

Recent Searches

diseases1935lunasbaleumaagoshelpedsinkwakassunud-sunuranpagamutanipantalopiglapbuslonaiiritangfansculturesromanticismolinabrasotrabahocultivopulisnapatingalahidingadmiredsistemaskapitbahaysasabihindiyosmaidganidmagbibigayforskel,nanalopigilansumindiuusapankulungannatalongtelebisyonhagdanannaisbateryadietkastilangtopicpiecestomwikarenatoinangvistnatuloyiskotransparentpagkaawaleadingedukasyonlarawanhistorymatuloggamepagsisimbangibinentanakapayongobservererlipatparusahantowardsbarongpasaheromagkaparehobarangaybumahamagsalitalasonhanapbuhaysaanbutoarawbinanggananunuri1929sahigpagsumamostillpamagatartistsnatitiyaknaglakadtamiskarnabaltrentacreceriniintaypalayoimbesmakikipagbabagbansangmagta-trabahopayongprinttipnakauslinghiraptrycycleumiilingyumuyukoipinikitultimatelyngipingshorttumaposnanaypapalapitsignificantpalayanumiiyakresortalaalamaaariaywanmagisipmahiwagavaliosatarcilamanlalakbaymagpuntatumindigbaguionakabiladcuthalosutilizanminamahalkanangoverviewcontinueimprovedoutlineitlogipapaputolnagkakakainkumakalansinglumalangoyconditionconsuelopaanannabighaniininomlihiminilabasayawpakanta-kantangnagdaramdambumisitatumalonstarspalaisipanpumayagendeligwalang-tiyakipanghampaskalabankinukuyomkantahanpangkatpotentialinalagaanmanahimikbreakharingiparatingmayabangvehiclestitapumuntanaapektuhaniiyakrhythmmakinangprofoundgrahamseeligaligdasalkahongmaaricigarettekalawakanbotantehinigitmatipunokumpunihinkaugnayanipaghandanalagutannagpuyoschamberschickenpox