Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "diseases"

1. A balanced and healthy diet can help prevent chronic diseases.

2. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

3. Antiviral medications can be used to treat some viral infections, but there is no cure for many viral diseases.

4. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

5. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

6. It has been found that by abstaining from smoking a person may be cured of many diseases

7. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

8. Viruses are small, infectious agents that can infect cells and cause diseases.

Random Sentences

1. Sambil menyelam minum air.

2. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

3. Bakit nga ba niya papansinin si Ogor?

4. Itinuturo siya ng mga iyon.

5. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

6. Sa dakong huli, mas pinili ko pa rin ang magsinungaling kaysa sabihin ang totoo.

7. Nakakamangha naman ang mga tanawin sa lugar nyo Edwin.

8. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

9. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

10. Therefore, we should all steer clear of this bad habit of smoking cigarettes

11. El agua tiene propiedades únicas, como la capacidad de disolver sustancias y regular la temperatura.

12. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

13. Napakabango ng sampaguita.

14. Gumawa ako ng cake para kay Kit.

15. Hinawakan ko yung tiyan ko, Konting tiis na lang..

16. Pour maintenir sa motivation, il est important d'avoir des objectifs clairs et réalisables.

17. Climbing without proper equipment is incredibly risky and dangerous.

18. Sinabi naman ni Apollo ang mga dapat gawin.

19. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

20. Ang kalayaan ay hindi dapat magresulta sa pagpapahirap sa ibang tao.

21. The scientific community is working to develop sustainable energy sources to combat climate change.

22. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

23. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

24. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

25. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

26. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

27. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. Kanino humingi ng tulong ang mga tao?

30. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

31. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

32. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

33. Ang mahal naman ng laptop na binili ni Andy.

34. Nagpunta ako sa may lobby para magisip.

35. Ang batang matuto, sana sa matanda nagmula.

36. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

37. Hindi dapat natin balewalain ang mga banta ng kalamidad, datapapwat ay hindi naman ito sigurado na magaganap.

38. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

39. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

40. Nasa Canada si Trina sa Mayo.

41. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

42. It has changed the way that people consume media, it has created new forms of entertainment, and it has played an important role in politics, education, and advertising

43. Mapapansin kaya sa dami ng 'yong ginagawa

44. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

45. A king is a male monarch who rules a kingdom or a sovereign state.

46. Ang tag-ulan ay isa ring panahon ng pagsusulat, pagbabasa, at panonood ng mga pelikula dahil sa hindi madalas makalabas ng bahay.

47. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

48. Gumawa siya ng eksamen para sa klase.

49. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

50. I always feel grateful for another year of life on my birthday.

Recent Searches

diseasesbalinganmaubospulitikogulangnakatinginhinintaynanoodtawanankuboinfusionesbayangrobinhoodnovemberindustryhinogpepebingoseniorkikohumblesikoipinasyangsundaebecameoutlinedikyammagbigayanhikingsumusunoiniibigandresoverallpshearnumingitkamatisreadersgatheringibigtaingapetsanggenebilugangcineonlinebeginningsgrammarsalatmahiwagaincredibletusindvisjoypdaconectanenforcingoliviaofteerapfuncionartheseinalisipasoklaylayminutebellexperiencesespadastringclassesgitanasitemseitherfallalibagechavesarilimonetizingcrazycakebinabaledbroadartificialchefbinigyanpalayanpaghuninametipidkarnabalpinapataposadecuadolumiwagdiyaryopangangatawanmulikalakihantruekabarkadakristonatulakmanilbihanigigiitkinasuklamannag-aalalangnagpapasasadesisyonanenergy-coaldonsawamagkaibaproducegetpagkabataangkannaggalanatinorasangalaannagtrabahonapapatinginmalamangkidkiranulosinumangusapuntahanpangetattentionhatingpinaladibabanausaltiktok,lenguajebecomekaninumanbibilhinsadyangmagwawalaprogrammingtwinklemaniwalaprotestamateryalesarbejdsstyrkeskyldesmalayapaglingaparkinginferioresspeedaalistawamagbibiyaheshinessagingctilesiwasiwasitaaspag-aanisongmangkukulamkangabsmadamotaanhindescargarkatawangfollowinggayunmanpaninigasboholnakabluenagbantaysiyanatutuloghumalomagsisimulapagkainjailhouserabbatagpiangde-lataninapag-asalihimtuloyfestivalesbuwalkagipitanmagtipidduonimaginationsaringmaghatinggabiconcernpunoline