Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "surroundings"

1. Technology is a broad term that refers to the tools, methods, and techniques that humans use to improve their lives and surroundings

Random Sentences

1. Apa yang bisa saya bantu? - How can I help you?

2. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

3. Elektronik kan være en kilde til underholdning og sjov.

4. Tinuro ng coach kung paano kontrolin ang bola habang tumatakbo.

5. Uminom siya ng maraming tubig upang iwasan ang bungang-araw.

6. Human trafficking is a grave crime that needs immediate action worldwide.

7. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

8. Ang pagsisindi ng kandila tuwing gabi ay naging isang ritwal na nagbibigay ng katahimikan sa kanyang isip.

9. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

10. Ano ang pangalan ng babaeng buntis?

11. Maganda ang bansang Singapore.

12. Mapapa sana-all ka na lang.

13. I am not enjoying the cold weather.

14. Les travailleurs peuvent être affectés à différents horaires de travail, comme le travail de nuit.

15. Helte kan være en kilde til håb og optimisme i en verden, der kan være svær.

16. Dwyane Wade was a key player in the Miami Heat's championship runs and known for his clutch performances.

17. Naghingi ako ng pahintulot na hiramin ang kotse ng aking magulang para sa isang family outing.

18. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

19. Tanah Lot di Bali adalah sebuah pura Hindu yang terletak di atas karang dan menawarkan pemandangan laut yang indah.

20. La música es una forma de arte que se disfruta en todo el mundo.

21. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. Einstein's work led to the development of technologies such as nuclear power and GPS.

24. La realidad es que nunca sabemos lo que nos depara el futuro.

25. Dalam Islam, doa yang dilakukan secara berjamaah dapat meningkatkan kebersamaan dan kekuatan jamaah.

26. Illegal drug traffic across the border has been a major concern for law enforcement.

27. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

28. Malapit na naman ang bagong taon.

29. Ang abuso sa hayop ay isang krimen na dapat mapanagot ang mga nagkasala.

30. I caught my boyfriend staring at a picture of a pretty lady on his phone.

31. The website's security features are top-notch, ensuring that user data is protected from cyber attacks.

32. Anong klaseng kuwarto ang gusto niya?

33. Ang mga punong-kahoy ay kabilang sa mga pangunahing likas na yaman ng ating bansa.

34. Il est important de prendre en compte les risques potentiels et de faire des recherches approfondies avant de décider de participer à des activités de jeu.

35. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

36. Ang paglapastangan sa mga relihiyosong simbolo ay labag sa mga patakaran ng paggalang sa iba.

37. La conexión a internet se puede hacer a través de una variedad de dispositivos, como computadoras, teléfonos inteligentes y tabletas.

38. Si Aling Pising naman ay nagpupunta sa bayan upang ipagbili ang mga nagawang uling.

39. Environmental protection requires a long-term vision and commitment to future generations.

40. Bumili ka ng blusa sa Liberty Mall.

41. At habang lumalaki na nga ang bata ay unti-unti itong naging bihasa sa paghahabi ng mga tela.

42. "Dogs leave paw prints on your heart."

43. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

44. Tinulungan ko siyang dalhin yung mga plato sa dining room.

45. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

46. Landet er et af de førende lande i verden inden for økologisk landbrug, og det er også et af de førende lande inden for vedvarende energi

47. Mathematics provides a systematic and logical approach to problem-solving.

48. Mga nuno, patawarin po ninyo ang aking anak.

49. The chef is cooking in the restaurant kitchen.

50. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

Recent Searches

surroundingscollectionsnakinigaccederpagbatiwordeithermapaikotevolvesabognatakotconectadosmakakawawafuncionesrestawandoingincrediblelumiwagsmokinghoundnamajeepneyeasyilogkurbatanapapatinginnaggalakumakalansingtoolkulisapaayusinsumagottumikimoperatengpuntastudentespadaligawankatuladseveralinorderkuwartatumawagdrawinghumayodumaanumiiyakhayaangnagplaymaligayapundidocardiganmahusaypingganlargenagsuotteleviewingpeksmanusakanginakenditumakasbinatakleadingsanggolmasaholmamimiliamericancanteen1929ipaliwanagnagkakasyasocialestaleleadershdtvwithoutmamivarietyhinamonwidelymatariktuluyanmataposdagligesocialeflexiblemasyadongstarted:personalmahirapmedikalmakapalnagdarasalgagawinpautanghawakangamitintatlongsiniyasatstarteditinagoreftirantesignificantsumalatransport,masukoljolibeetherapymournedbabaengmukahalmacenarinilabasschedulemanageroutpostumakbaysakaysumasambalumabaspatongpageantbecomessabisubjectmahulogexamplenagwagileadsumugodsisikatnegosyopanghihiyangteknologimagasawangtinaassiemprethereforevaliosagulangmakikipag-duetopambahayinfluencesbakitnakatayopinataybarrerascarriessumangbatopinagawaunderholderblendgabrielnagawakaagawumiinomsumasakitkuwebaumiwaslumibotinalalayannakatapatlaki-lakireachwhetherpalawanartematatalimpapaniginirapannatulaknagyayangsecarsemagworkpumasokpanaforcesilongspeechkuripotdemocracynapaiyaktahanansuriinmahiligimpitnasisiyahanlivesmalawakpag-iyakhumaboldecisionspinagkasundosaan-saanagawhomeworkwalis