Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "combined"

1. But television combined visual images with sound.

2. The eggs are beaten until the yolks and whites are well combined.

Random Sentences

1. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

2. Kapag walang magtutulungan, walang magtatagumpay.

3. Nakapag-travel ako sa ibang bansa kaya masayang-masaya ako ngayon.

4. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

5. Dahil dito nag-away-away ang mga mababangis na hayop at mga ibon.

6. When life gives you lemons, make lemonade.

7. The website's user interface is very user-friendly and easy to navigate.

8. Nalungkot ang Buto nang dumilim na ang paligid.

9. Pininturahan nila ang bahay ng puti upang magmukhang maaliwalas.

10. She has been exercising every day for a month.

11. Mas mahalaga ang kabutihan ng kalooban kaysa sa kababawang kasiyahan.

12. Las serpientes son reptiles que se caracterizan por su cuerpo largo y sin extremidades.

13. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

14. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

15. Napakabuti ng doktor at hindi na ito nagpabayad sa konsultasyon.

16. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

17. Nagdulot umano ng matinding trapiko ang biglaang pagkasira ng tulay.

18. Nagpabakuna kana ba?

19. Hinawakan niya iyon sa magkabilang tirante.

20. Scissors with serrated blades are useful for cutting through tough materials like cardboard or thick fabrics.

21. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

22. Hinde sa ayaw ko.. hinde ko lang kaya..

23. Mobiltelefoner, tablets og computere er eksempler på elektronik, som mange bruger hver dag.

24. LeBron James is a professional basketball player widely regarded as one of the greatest athletes of all time.

25. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

26. Ilang taon ang lumipas at hindi pa rin nakikita ang gong.

27. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

28. Mga prutas ang tinitinda ng tindera.

29. The height of the basket and the court size varies depending on the age and skill level of the players.

30. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

31. Les personnes âgées peuvent faire face à la fin de leur vie avec courage et dignité.

32. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

33. Up above the world so high,

34. Hanggang sa dulo ng mundo.

35. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

36. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. Nandito ako sa entrance ng hotel.

39. She admired the way her grandmother handled difficult situations with grace.

40. Mi aspiración es ayudar a los demás en mi carrera como médico. (My aspiration is to help others in my career as a doctor.)

41. Ang gubat ay puno ng iba't ibang magaganda, makukulay, at mababangong mga halamang namumulaklak.

42. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

43. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

44. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

45. Ang mumura ng bilihin sa Shopee.

46. Ayaw kong sumakay ng bus kung minsan.

47. Ang debate ay ukol sa mga isyu ng korapsyon sa gobyerno.

48. Nagsusulat ako ng tula bilang pagpapahayag ng aking damdamin.

49. Binigyan si Hidilyn Diaz ng house and lot bilang bahagi ng kanyang mga gantimpala.

50. La foto en Instagram está llamando la atención de muchos seguidores.

Recent Searches

boholayokohugiscombinedartistssonidocoalsumuothetoninongrosellemataposplasamalezarevolucionadonakitanakakagalingnakakapagpatibaynagpapaniwalanakakunot-noongpagbabagong-anyobrucehumayomalapitbridepamimilhinsolidifyhusayhumblepinag-usapanjudicialpinamalagimumuntingnagcurvecultivaiintayinnapipilitanalbularyoglobalisasyonmakangitinakatiranginspirasyonpapagalitankalayaankatutubonakatuwaangkongresointensidadumagawpamumunowatawatkomedortotoongsasakyantangeksibiniliencuestastitanalakistrategiesnagwikangdescargarsunud-sunodpinaulanannamilipitmadadalakasawiang-paladhinilakalaroendeligbinilitalinomakisuyobinatipahirammananaoggymreynadustpanguidancebutasturoniyongcoughingisipankainanitinulospampagandabantulothinanapmahigittinapayaudiencehinigitpresleykriskapabalanglagunazoothankaddictionvelstandisasabadpunung-punokonglumbaynagulatmembersbumabahabingbingdaladalasinkresumenumutangpalagiattractiveinomskypemaunawaanitinaponbagkustahananisippanayleftpaskoamparomakisigtuwingpaperconditioningfigurelimitmichaelletmind:actingfertilizerabidisappointlargerencounterhydelmegetnerofanstilapaamuchosnaggingintroductiondividesbabaikawlightsconsiderarcoachingnaroonwelltitigilnangangalitiloiloeducationalbalangcebukilosuelospeedbawatdinanaspresencenaturalhierbasbalitabangkokinalalagyannatitiramalabonapaplastikantodasnawalanasuklamsinisinapatingalafaulthinampasjoecurtainsbook,mayamayaseenfilmmahihirapmanghikayatdeliciosanasiyahankumakantanapapahintonumerososnakabawi