Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "donde"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

3. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

Random Sentences

1. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

2. Nakatingin sa araw, humakbang siya upang kunin ang pingga ngunit sa paghakbang na iyon, bigla siyang pinatid ni Ogor.

3. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

4. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

5. Sa bawat pagkakataon, dapat nating ipaglaban at ipagtagumpay ang ating kalayaan.

6. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

7. The telephone is a device that allows people to communicate over long distances by converting sound into electrical signals and transmitting them through a network of wires or wireless connection

8. The wedding photographer captures important moments and memories from the wedding day.

9. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

10. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

11. La paciencia nos enseña a esperar el momento adecuado.

12. Maarte siya sa mga klaseng pagkain kaya hindi siya nakikisabay sa mga inuman sessions.

13. Umuwi na tayo satin.. naramdaman ko ang pagtango niya

14. Los asmáticos a menudo experimentan tos como síntoma de un ataque de asma.

15. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

16. May I know your name for our records?

17. The cake was shaped like a castle and was the centerpiece of the princess-themed party.

18. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

19. Gabi na po pala.

20. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

21. Accepting the job offer without reading the contract was a risky decision.

22. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

23. He blew out the candles on his birthday cake and made a wish.

24. Nami-miss ko na ang Pilipinas.

25. ¡Claro que sí, acepto tu invitación!

26. It was founded by Jeff Bezos in 1994.

27. We wasted a lot of time arguing about something that turned out to be a storm in a teacup.

28. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

29. Einstein's legacy continues to inspire and influence scientific research today.

30. Ilang gabi sila titigil sa hotel?

31. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

32. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

33. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

34. Pati ang mga batang naroon.

35. Marami kaming handa noong noche buena.

36. Ang paggamit ng droga ay nagpapakita lamang ng kahinaan sa tao.

37. Sa kabila nito, nanatili siyang aktibo sa politika ng Pilipinas pagkatapos ng pananakop.

38. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

39. ¿Te gusta la comida picante o prefieres algo más suave?

40. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

41. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

42.

43. La acuarela es una técnica de pintura que utiliza pigmentos mezclados con agua.

44. Nasa Diyos ang awa, nasa tao ang gawa.

45. Isang magdadapit-hapon, habang nagpapasasa si Kablan sa marangyang hapunan, isang uugud-ugod na matanda ang kumatok sa kanyang bahay.

46. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

47. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa mga tao sa paligid natin.

48. Gusto ko na talaga mamasyal sa Japan.

49. Kapag aking sabihing minamahal kita.

50. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

Recent Searches

establishpaki-chargetinutopdondeoffentligproducts:tsssbulaknaritotolforståayawforcesisinakripisyopasyanakapuntaherramientaslamaninalokhoneymoondali-dalingyumaoplaysprimerosnamungaoliviamassessabongnaroonparatingpagpapakilaladuminakauslingexperttalentedgodthmmmmaumentarkontingparagraphspagbebentananunuksokombinationcigarettesnaghuhumindigdisensyokamatismonsignorvedvarendemahabangpogife-facebookarguedadkinalakihanmagdilimcoaching:abut-abotnegativebasahintinitindamagselosnaguusapspeechginoongmapadaliatensyonmaatimcharitablekumidlatdisposaldaantipidsagapaddingnavigationpagtataassparknamingsimplengpowersprocessinhaleulinglumilipadjunjunmagbubungacharmingrangenaghinalamakausapenviarhabitpaglakiestadosflashbulatelandeaguamiyerkulesnapatayokamaypabilipagsisisipalamutislavetambayanadverselymobilemillionsheytinahakvidtstraktsulinganpesochildrenpag-aapuhapsayomartialorasankinakailangangpanatagmaghahatidkaarawanbahagyafredfarmsubalitpolorosekaninamakatulongsiniyasatdulotnabigyankangitanmedidaresignationmapahamakadecuadowastelabiseclipxeuponintroducemakakasahodiilankumikinigpaggawaalintuntuninpamahalaanmahinadoble-karagumalaairconnakakapagpatibayginugunitatsinaalamhinihintaymagkasabayfinishednapaiyakrockguardahumahangospayapangpesosdevicesmedikalrelievedgrewpagkuwanpagkabatanapuputoleffortsupuandistansyacaraballococktailandreslalakeikinakatwiranklasetataasdennemarketplacesadganginuulcerpapuntangsongsempresaslaloisinuotbangladeshhitsurapartskakuwentuhaninjuryvideos,