Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "disease"

1. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

2. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

3. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

4. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

7. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

8. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

9. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

10. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

11. The patient's family history of leukemia increased their risk of developing the disease.

12. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

Random Sentences

1. Tendremos que tener paciencia hasta que llegue nuestro turno.

2. She decorated the cake with colorful sprinkles and frosting.

3. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

4. Pumasok ako sa cubicle. Gusto ko muna magisip.

5. Ang pagkapanalo ng koponan ay siyang ikinagagalak ng lahat ng sumuporta sa kanila.

6. Mi esposo y yo hemos estado juntos por muchos Días de San Valentín, pero siempre encontramos una manera de hacerlo especial.

7. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

8. Les archéologues utilisent la science pour comprendre les cultures du passé.

9. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

10. Maluwag ang parisukat na sementong kinatitirikan ng gripo at ang dulo ng pila'y nasa labas pa niyon.

11. The platform has implemented features to combat cyberbullying and promote a positive online environment.

12. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

13. Ang galing nya maglaro ng mobile legends.

14. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

15. Pare-pareho talaga kayo mga babaero!

16. Honesty is the best policy.

17. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

18. Nahulog ang bola sa dagat kaya lumangoy si Rico para kunin ito.

19. Gamit niya ang kanyang laptop sa proyekto.

20. Mange transkønnede personer oplever at blive udsat for chikane, mobning og vold på grund af deres kønsidentitet.

21. Arbejdsgivere tilbyder træning for at forbedre medarbejderes færdigheder.

22. Magaling magturo ang aking teacher.

23. En sund samvittighed kan hjælpe os med at tage ansvar for vores liv og handlinger.

24. Eeeehhhh! nagmamaktol pa ring sabi niya.

25. Haha! Bad mood na bad mood ka ah?

26. Agama juga sering menjadi landasan bagi hukum dan kebijakan di Indonesia, dengan prinsip-prinsip agama tertentu tercermin dalam sistem hukum negara.

27. Nakuha ko ang first place sa aking competition kaya masayang-masaya ako ngayon.

28. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

29. Paano siya pumupunta sa klase?

30. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

31. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

32. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

33. Nagising ako sa marahang pagtayo ni Maico.

34. Lumabas ng simbahan ang mga tao nang limahan matapos ang misa.

35. Ang magalang na tindero ay laging may malalim na respeto sa kanyang mga kostumer.

36. Women have a higher life expectancy compared to men, on average.

37. Many cultures have their own unique traditions and customs surrounding weddings.

38. Gumagawa ng cake si Bb. Echave.

39. It's complicated. sagot niya.

40. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

41. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

42. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

43. Napatakbo ako sa kinalalagyan ng landline ng tumunog yun.

44. Scientific research has shown that regular exercise can improve heart health.

45. Si Mabini ay naging pangalawang pangulo ng unang Republika ng Pilipinas.

46. Itinago ko ang mga sulat para sa inyo.

47. Doa adalah upaya komunikasi seseorang dengan Tuhan atau kekuatan yang lebih tinggi.

48. Matagal ng tradisyon ng mga Pilipino ang pagsamba sa poong Nazareno.

49. Investing requires discipline, patience, and a long-term perspective, and can be a powerful tool for achieving financial goals over time.

50. "Ang taong nagigipit, sa patalim kumakapit" ay isang bukambibig na nagpapakita ng kakayahan ng tao na gumawa ng mapanganib na mga hakbang kapag sila ay nasa kritikal na sitwasyon.

Similar Words

diseases

Recent Searches

sikippaketedustpandiseasesakimngisilabinsiyamtshirtgoodeveningmukaparikagandaparkingmalayangkasobinilhanstohinogtignanmangeseniormagulangpiecesburmamodernegrewusosinagotelvismakisigduonmenosgrammartapatganapunsolikelybataycommissionmasksumusunoumingitfeltstillsamfundlamesalutoiskobecomeilogpeepyearsburdenintroducecebutrafficgabeso-calledaalisnagreplyzoomcryptocurrencyjackzmatchingabiinternetmatabacoinbaselaylaytandadaangsumalangpuntateachurimentalmulirefersditomillionsresulteksaytedtopic,donetwinklesumapittrackspeeddrewfloorcountriesschedulegracepinagsasasabitabasbinentahanslavethoughtsledrelativelycrossdirectdulaipinaplatformsdaratingpracticadofascinatingenforcingprogressthirdstartededitorhateclockpatrickgitnacasesumarawsambitfourseparationgraduallykumbinsihintandang1977maispunongkahoymalambingpagnanasamagbabakasyonmapagodnagmakaawabarcelonamatanagkalatactualidadmamimilipaghuhugasmaglalarocigarettebarongginhawathankfulfillmentyamanhumahangoslaybrarisinampalpinangalananipanghampasnilulonallottedmatange-explainhaddingginkenjigigisinginspireenergytanganguidancebalinganmaatimpagdamiroofstockhinintaytiyanbaguiolayuanmatalimopportunitybayangsirapampagandashadescoughingparangnagsusulatmakapangyarihannakapangasawakinakitaanmagta-trabahonakakapagpatibayikinatatakotmagbagong-anyopagsasalitanakikini-kinitacuriousmagsayanglitoshipanitobibisitasasayawinkasangkapannagtungonapapatungomagkaiba