Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "disease"

1. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

2. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

3. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

4. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

7. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

8. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

9. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

10. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

11. The patient's family history of leukemia increased their risk of developing the disease.

12. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

Random Sentences

1. Det kan omfatte spil som kasinospil, lotteri, sportsbetting og online spil.

2. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

3. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

4. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

5. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

6. Tanghali na nang siya ay umuwi.

7. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

8. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

9. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

10. Kayo ang may kasalanan kung bakit nagkaganito ang buhok ko!

11. The restaurant was full, and therefore we had to wait for a table.

12. Tumahol ang aso at natakot ang pusa.

13. Me encanta la comida picante.

14. Ang pasya nang pagkapanalo ay sa tela ng matanda.

15. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

16. El que espera, desespera.

17. Aku rindu padamu. - I miss you.

18. Ilan ang computer sa bahay mo?

19. Babalik ako sa susunod na taon.

20. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

21. Ano ang naging sakit ni Tita Beth?

22. Mi amigo es muy bueno con las palabras y siempre me ayuda con mis discursos.

23. Maari bang pagbigyan.

24. Dumating siya mula sa Bikol kahapon ng umaga.

25. Hinugot niya ang kanyang hininga bago siya sumagot sa tanong ng guro.

26. Hendes ansigt er som et kunstværk. (Her face is like a work of art.)

27.

28. La realidad nos enseña lecciones importantes.

29. Hinagud-hagod niya ang mga kamao.

30. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

31. Ang pinakamalapit na lugar na kanilang narating ay mababa pa rin ang altitude.

32. The widespread use of the telephone has had a profound impact on society

33. Cars were honking loudly in the middle of rush hour traffic.

34. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

35. Pwede ba kitang tulungan?

36. Sa matinding sikat ng araw, tila sya ang mandirigmang sugatan, ngunit matatag na nakatindig sa pinagwagihang larangan.

37. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

38. If you're trying to get me to change my mind, you're barking up the wrong tree.

39. Kucing dikenal dengan sifatnya yang lucu, manja, dan lincah.

40. Isa kang hampaslupa! saad ng matapobreng babae.

41. Ano ang gusto mong gawin kapag walang pasok?

42. That'll be 4,788.50 pesos ma'am.

43. Lebih dari sekadar praktik keagamaan, agama juga merupakan bagian penting dalam membentuk moral dan nilai-nilai yang dijunjung tinggi di masyarakat Indonesia.

44. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

45. Nag-ugat sa puso ni Durian na mahalin ang sakop ng kanyang ama.

46. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

47. The project is taking longer than expected, but let's hang in there and finish it.

48. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

49. Sana makatulong ang na-fund raise natin.

50. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

Similar Words

diseases

Recent Searches

diseasebumitawmagasawangbeastdinmensahekumakantathereforeknowsneedsmagpapigildyipnikidkiranlumamangnalalabingnararapatdiinprincipalesnakatuonsay,kontinentengmagsunogculturasdisposalsapatoslumagoisinaboyminatamisnakitulogtilgangexamplemaabutanginaganaphinogpongnuhrestaurantkatagakayavivahinabolbagobeyondbringingviewsstandcontinuestrackkuninfistspinabayaanmakipag-barkadamakangitikarwahengkinagalitannapaluhapalaginag-aalalangbio-gas-developingpasensiyatinaasansalaminmagpaniwalamusicianmang-aawitmakakasahodbukasinvesting:nahintakutanbabayaranwidespreadrenombrehumalakhakpoliticalnagagandahanikinabubuhaygumisinghouseholdspupuntahanmagpapagupitsasagutinmahawaankumikinigpaki-ulitsinasabimedicinekahulugannagtakainjurybiyernessyangtelefonerdumaannabigladesign,labisrewardingtinuturongitimilyongtamadmagdaansumasaliwtawanankumapitlutobranchgasmenseriousbibilhinsparekutsaritangbalatsalaharapmapilitangproducts:dinaananmissionpusaparehasinintaynasuklambisikletaadditionnitongbasahandalandanpshcontent,sinunodshockbellcompartenditodelkakilalascientistjandecreaseinsteadsyncthirdyeahkamalayanedititorecentcynthiamalakingcompletingpangungusapmapagbigayopisinabayanhalamanvisualbaotodonangangahoykuryenteterminonailigtaskungmatapobrenggraphickapeteryapagsagotaksidentecurtainsbibilibumagsakpalengkehawlamalilimutannapakaipinansasahogvariousipipilitworldaddressstudentbigkararatingsino-sinobutase-commerce,wonderpromotemaibabalikmatalimteachernapuyatmaulitleadingkagandalifenoomayamankahilingan