Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

12 sentences found for "disease"

1. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

2. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

3. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

4. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

5. High blood pressure can increase the risk of heart disease, stroke, and kidney damage.

6. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

7. Leukemia can be acute or chronic, depending on how quickly the disease progresses.

8. Leukemia research continues to improve our understanding of the disease and develop more effective treatments.

9. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

10. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

11. The patient's family history of leukemia increased their risk of developing the disease.

12. The scientific consensus is that vaccines are safe and effective in preventing the spread of disease.

Random Sentences

1. Nakipagtagisan sya ng lakas sa mga kalaban.

2. Les parents sont encouragés à participer activement à l'éducation de leurs enfants.

3. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

4. Vous parlez français très bien.

5. Ang aking anak ay madalas manood ng Baby shark sa youtube.

6. Ang sakit ng kalingkingan ay ramdam ng buong katawan.

7. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

8. La película produjo una gran taquilla gracias a su reparto estelar.

9. Aray! nagcurve ball sya sa sakit sa sahig.

10. Sa tingin mo ba may balak ako? he grins.

11. The stock market can be influenced by global events and news that impact multiple sectors and industries.

12. Hindi ito maganda na maging sobrang takot sa lahat ng bagay dahil lamang sa agam-agam.

13. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

14. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

15. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

16. Isang araw, isang matanda ang nagpunta sa bahay ng bata at hinamon niya ito.

17. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

18. Maarte siya sa kanyang kagamitan kaya hindi siya nagpapahiram ng kanyang mga bagay.

19. Si Ogor ang kanyang natingala.

20. Edukasyon ay paghusayan upang malayo sa kahirapan.

21. Nang biglang lumindol at nawala ang matabang babae, isang diwatang ubod ng ganda ang lumitaw sa harap niya.

22. Wala ho akong kinukuha sa inyong pitaka.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Bukas ang biyahe ko papuntang Manila.

25. Sweet foods are often associated with desserts, such as cakes and pastries.

26. El agricultor contrató a algunos ayudantes para cosechar la cosecha de fresas más rápido.

27. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

28. Many churches hold special Christmas services, such as midnight Mass, to celebrate the birth of Jesus and share the message of love and compassion.

29. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

30. A couple of phone calls and emails later, I finally got the information I needed.

31. Ow, sorry nagising ata kita. aniya.

32. Magic Johnson was a skilled playmaker and led the Los Angeles Lakers to multiple championships.

33. Sa muling pagtuturo ng relihiyon, natutunan ng mga bata ang konsepto ng purgatoryo.

34. Bumili ka ng blusa sa Liberty Mall.

35. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

36. Isang araw, naabutan ni Nicolas si Helena sa palasyo.

37. Ang pangalan niya ay Ipong.

38. The police were searching for the culprit behind the rash of robberies in the area.

39. Crush kita simula pa noong nakita kita sa klase natin.

40. Bakit hindi nya ako ginising?

41. Ang aso ay tumakbong palayo nang makita ang estranghero.

42. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

43. Tumawa rin siya ng malakas, How's Palawan? tanong niya.

44. Nanalo si Ton Ton bilang presidente ng kanilang paaralan.

45. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

46. Panay pa ang post nito sa facebook ng bagong damit eh hiram lang naman nya ang lahat nang yun.

47. Eksport af forskning og udvikling er en vigtig del af den danske økonomi.

48. Nang makita ng mga kababayan niya ang bunga naghinala silang naroon sa punong iyon ang kanilang gong.

49. I know I'm late, but better late than never, right?

50. Nahuli ang magnanakaw ng mga sibilyan at iniharap ito sa mga pulis.

Similar Words

diseases

Recent Searches

diseasemarilouawardnilapitanfederalbagosumagotsumigawosakaseniorvistdisyembrejenakahilingankasiburmaarghlapitansalaipapaputolsupremeaudiencenilulonabenewalisleytefaketelangfeedback,aywanorugasapatlegislativeimaginationeeeehhhhdoglabanhumanosbluetherapywidespreadmacadamiaeveningfansworrystrategypangulobinabaancesdollarideapossiblerateislamainitaleitsmagalingtechnologiesrelevantestablishedinfluenceonlydosinteriorboydecreasecontrolamapedit:gappasinghalsmallayansumibolpag-aagwadorlatestdumatingkumakapitkabilangpanggatongnagbabakasyonpantalonherramientastradesinundanpapayagtig-bebentenagkasunogtaong-bayansisidlannasaeducatingpolonapapikitdumalonanunurisimbahanjerrystringnasulyapanlalakinagre-reviewnagtatanimpupuntahanisinaraisinalaysayhalalannitongmayroonangaltalagasumpaininterviewingprinceduondiamondzoombarangaymediumilangmiyerkulessupilinlapishinding-hindinapaangatpeephinabihahatolmodernemillionshigpitansubalitcedulapambahaymagsusuotgalitinaasahannapapag-usapansalapinovelleskayaumiisodgagambatumulongfatherkasintahanbilianyomayabongmenosclienteslibagitemspinalutoawagrewspent1876magdapakainnagbungaorderinbarogabinganghelikinasasabikkagandahagnakumbinsiikinalulungkotmagbagong-anyovideos,gayundinnapapasayamatapobrengfollowing,unahinnatinagfotostravelereskwelahannagandahankinikilalangbalitanakatapattumagalmagkaharapmorningphilanthropynakayukonagpuyosnakadapakayabanganmagpagupitkinalilibingannalamanmakatulognanaogpagkasabinaliwanagan