Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "community"

1. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

2. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

3. The community admires the volunteer efforts of local organizations.

4. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

5. The scientific community is constantly seeking to expand our understanding of the universe.

6. The scientific community is working to develop sustainable energy sources to combat climate change.

7. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

8. They volunteer at the community center.

9. Uncertainty about the outcome of the election has caused tension in the community.

Random Sentences

1. Mga ganid sa kapangyarihan ang ilan sa mga pulitiko.

2. Sa dami ng nagnanais kumuha ng kursong iyon, mababa ang tiyansa niyang makapasok.

3. "Ang kabataan ang pag-asa ng bayan," ani ni Jose Rizal.

4. Elon Musk is a billionaire entrepreneur and business magnate.

5. Ayon sa albularyo, may nakabati raw sa sanggol kaya siya nagkasakit.

6. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

7. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

8. Magbabakasyon kami sa Banawe sa tag-araw.

9. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

10. Tatlong linggo kami dito sa Pilipinas.

11. Sa loob ng sinehan, pinagmamasdan niya ang malalaking screen na nagpapalabas ng pelikula.

12. Has she written the report yet?

13. La pintura al óleo es una técnica clásica que utiliza pigmentos mezclados con aceite.

14. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

15. Hubad-baro at ngumingisi.

16. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

17. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

18. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong nakakaranas ng mga krisis at mga suliranin sa buhay.

19. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

20. Sa huling pagkakataon ang mga isda ay nagsalita.

21. Napakaseloso mo naman.

22. We celebrated their promotion with a champagne toast and a slice of cake.

23. I don't want to cut corners on this project - let's do it right the first time.

24. Es importante estar atento a las plagas y enfermedades, y utilizar métodos orgánicos para controlarlas

25. Ayaw kong sumakay ng bus kung minsan.

26. Matayog ang lipad ng saranggola ni Pepe.

27. Butterfly, baby, well you got it all

28. Erfaring har lært mig at tage ansvar og være proaktiv.

29. Hindi dapat matakot sa mailap na mga pagsubok dahil ito ay makakapagbigay ng magandang aral.

30. Los héroes nos inspiran a ser mejores y nos muestran el poder de la bondad y el sacrificio.

31. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

32. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

33. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

34. At ang hawak nitong bangos na tig-bebeinte.

35. She exercises at home.

36. I am absolutely certain that I locked the door before leaving.

37. Uno de mis pasatiempos favoritos es leer novelas de misterio.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

40. Internal Audit po. simpleng sagot ko.

41. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil nakakasira ito ng morale at nakakapagpababa ng confidence.

42.

43. Ang kasamaan ng anak ay kaya pa nilang pagtiisan ngunit ang paglalait at paghamak sa kanila bilang magulang ay hindi na niya mapalampas.

44. Mataas sa calcium ang gatas at keso.

45. Ano ang binibili ni Consuelo?

46. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

47. Ang buhawi ay maaaring magdulot ng pagkalbo sa mga puno, pagbagsak ng mga poste ng kuryente, at iba pang pinsala sa imprastruktura.

48. "Love me, love my dog."

49. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

50. Wait lang ha, sasagutin ko na baka importante eh.

Recent Searches

lackmaihaharapcommunitykakutismanilasensiblebiglalayout,patunayansandalimagpuntanagkasunogamericanulamnagsagawakumikinig1977nabigayumalisluhaconventionalmabigyanpinagmamalakimamilubosenerotrainsarbularyocarlosumalaandywidelybinuksanwalngdraft:tumatakbohaliktinurobungacallingsiniyasatnapakahusaylansanganunti-untingnagawasiyudadkainispangingiminakarinigdennenagpasamalungsodkapangyahirankalayaanoverallmaglutosumunodmakapalalmacenarpreviouslykauntimakakabalikpangkatscheduleeasierpaperalticonsalikabukinstudentkahusayannegro-slavesvarietyhiwagamagpapaliteuropemasinoplumalakadhubadnaiinissaymalapalasyokaramdamannaiwangbinibiyayaanmagkakagustonaglabanakakapamasyalbayawakcreatejoshnamulatnangagsipagkantahannakuhamisteryomaranasankawili-wilitinangkapinabulaanbahagyabihirahikingpetsangmaliksitoomagkasakitbagkusnagpasangenerationsmaputigabi-gabigreatlyyonsalitangnahahalinhanpaglalabagod1000pamilihanflamencoh-hoyorkidyasrisefredkondisyonsupilintulunganhallnangampanyabridepagpiliganabusyyumabongmahiramlintaentryutilizarhiramdulatumindignabuhayclientesetslisensyadahonnilinistatloconectadosevilreadingnakabiladriskbingbingtraditionalmakapangyarihangtiyarenombretinapaytiemposnahintakutanpapuntangcover,pananglawawtoritadongjeepneybevaredaangkaraniwangnapakamisteryosokarapatanhumanosmoneytradisyonkuyakusinacultivashoppingstreetstorytirangloanscompanieslot,brasopwedesisentahinalungkatreplacedtanghalitalinolumbaymatikmankailanmanmerchandisekasuutanpalipat-lipatiskomagandangkisame