Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "community"

1. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

2. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

3. The community admires the volunteer efforts of local organizations.

4. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

5. The scientific community is constantly seeking to expand our understanding of the universe.

6. The scientific community is working to develop sustainable energy sources to combat climate change.

7. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

8. They volunteer at the community center.

9. Uncertainty about the outcome of the election has caused tension in the community.

Random Sentences

1. Bakit nga ba niya papansinin si Ogor?

2. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

3. Mahalagang magpakumbaba at magpakatotoo sa bawat sitwasyon, samakatuwid.

4. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

5. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

6. Baby fever can affect people of various ages, backgrounds, and genders.

7. The feeling of falling in love can be euphoric and overwhelming.

8. Isang araw, napagod na ang mga diwata sa away ng mga mababangis na hayop at mga ibon.

9. Las hojas de palmera pueden ser muy grandes y pesadas.

10. Mahalaga na maging bukas ako sa mga taong maaaring makatulong sa akin upang maalis ang aking mga agam-agam.

11. They knew it was risky to trust a stranger with their secrets.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Papaano ho kung hindi siya?

14. We celebrated their promotion with a champagne toast and a slice of cake.

15. Magkano po sa inyo ang yelo?

16. Hindi ko matatanggap ang kanilang panukala dahil mayroon akong mga reservations dito.

17. Fødslen kan være en fysisk og følelsesmæssig udfordring for både mor og far.

18. Pumunta ako sa Iloilo noong tag-araw.

19. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

20. Hinayaan kong maglabas ng malalim na himutok ang aking kaluluwa upang mapawi ang aking pangamba.

21. Ang empleyado ay na-suway sa pagsusuot ng hindi tamang uniporme sa opisina.

22. Dapat akong bumili ng regalo para kay Maria.

23. Kailan ipinanganak si Ligaya?

24. Sa pagdiriwang ng fiesta, ang bayanihan ay nagiging mas makikita sa paghahanda at pagdaraos ng mga aktibidad.

25. Lumipad palayo ang saranggola at hindi na nila nakita.

26. Después de la entrevista de trabajo, recibí la oferta de empleo.

27. Ang presidente ng Pilipinas ay nagpabot na ng ayuda sa mga mahihirap.

28. Matuto kang magtipid.

29. Microscopes require careful handling and maintenance to ensure accurate results.

30. He was one of the first martial artists to bring traditional Chinese martial arts to the Western world and helped to popularize martial arts in the United States and around the world

31. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

32. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

33. Pinuri umano ng mga eksperto ang bagong teknolohiyang inilunsad ng mga siyentipiko.

34. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

35. May masarap na mga pagkain sa buffet, pero mahaba ang pila para sa mga kubyertos.

36. Kinakailangan niyang kumilos, umisip ng paraan.

37. Ang korupsiyon ay laganap sa gobyerno.

38. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

39. Las serpientes juegan un papel importante en el equilibrio de los ecosistemas al controlar las poblaciones de roedores.

40. Kalahating pulgada ang kapal ng pakete.

41. Dumating ang mga kamag-anak ni Fe.

42. Biasanya, orang tua bayi akan mengundang kerabat dan tetangga untuk bersama-sama merayakan kelahiran anak mereka.

43. Pero pag harap ko, para akong nanigas sa kinatatayuan ko.

44. Magsasalita na sana ako ng sumingit si Maico.

45. Pantai Sanur di Bali adalah pantai yang menawarkan pemandangan matahari terbit yang indah dan tempat yang bagus untuk bersantai.

46. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

47. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

48. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

49. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

50. Lumipat si Carlos Yulo sa Japan upang mas mapalakas ang kanyang training sa gymnastics.

Recent Searches

communitymoderncountriesagilitymay-arigraceangconventionalstrategyemailphysical1973saringoutlineskumainmatakotnatulakikukumparanaturkatagalplanmetodepreviouslybadadditionallypartnereksenaofferstudentsincereleasedenvironmentformevilinterioritlogmonetizingbadingbowsteerpunong-punodevelopmentsequeinitquicklyeditorclienteroughworkingmurang-muranakaluhodtinikisinulattaga-nayonpapanhikyearsnamataymabihisanperanagpabotpahabolnapakabilislaruinmisyunerongkastilangginawaranbarongairplanesgumisingphilosophicalpublicitymatulunginlagunadiscoverednagsisikainnatagalanmalayanglalongstruggledguhitpunsosumakaysubalit1940magpuntadailyubodestarbarcelonaissuesnaiilangbanawedecreasenuclearkapilinglalabhanbookexamplenagbanggaandadalawmakatulogumiisodnatigilansinimulanpakiramdamkablaninstitucioneskadaratingmadaminagdaramdamelitesinunodbabesahitstaplebisigcryptocurrencyboksingbataymoodthenconvertidasboyetpagkakatuwaankinakitaandurimagkakailanawawalanalalaglagpundidomagkapatidmagnakawpagkakayakapmalalakimamalasbayadsinusuklalyannakuhangtatawaganlungsodmganagdalapaglalabadapinakamahabanagsimulanapilividtstraktshadesmaximizinggawingbayaningakmangsandwichcaraballosumamaimikberetihinalungkatemocionesnabiglasigurotugonmaayospinalayasinventadosaboglangkayrolandawardguidancekalupiaffiliategalakthankwasakinatakefatheranihinimagestiningnanpagputinatulogangalhiningihetokinainpabalanghomesconsumelaybrarieducationbilibpaskonghveryelopasokedsaoliviamaingatdiamond