Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "community"

1. He returned to the United States in the late 1950s, and quickly established himself as a leading figure in the martial arts community

2. Tesla has a strong and passionate community of supporters and customers, known as "Tesla enthusiasts" or "Teslaites."

3. The community admires the volunteer efforts of local organizations.

4. The Lakers have a strong philanthropic presence in the community, supporting various charitable initiatives and organizations.

5. The scientific community is constantly seeking to expand our understanding of the universe.

6. The scientific community is working to develop sustainable energy sources to combat climate change.

7. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

8. They volunteer at the community center.

9. Uncertainty about the outcome of the election has caused tension in the community.

Random Sentences

1. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

2. Nagulat siya ng makita niya ang isang usa na malapit ng kainin ng isang tigre.

3. Sa tapat ng tarangkahan, may malalaking bulaklak na de-korasyon.

4. Nasi kuning adalah nasi kuning yang biasa disajikan pada acara-acara tertentu dan dihidangkan dengan berbagai lauk.

5. Don't worry, it's just a storm in a teacup - it'll blow over soon.

6. Ang pagbasa ng mga positibong pananaw at inspirasyonal na mga salita ay nagdudulot sa akin ng isang matiwasay na pananaw sa buhay.

7. Kumain ako ng sinigang sa restawran.

8. Napapikit ako sa takot nang biglang nagitla ang bubong dahil sa malakas na ulan.

9. Walang matimtimang birhen sa matiyagang manalangin.

10. Ang malalakas na tama ng kidlat ay binulabog ang langit at nagdulot ng takot sa mga tao.

11. Einstein was a pacifist and spoke out against war and violence throughout his life.

12. Nagkakatipun-tipon ang mga ito.

13. Oo. Tatawagan ka daw niya pag nandyan na siya.

14. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

15. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

16. Cryptocurrency operates independently of central banks and governments.

17. Ang pangamba ay kadalasang sanhi ng hindi pagtanggap sa mga hamon sa buhay.

18. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

19. Hendes skønhed er betagende. (Her beauty is mesmerizing.)

20. Las escuelas también pueden tener una biblioteca y recursos educativos en línea para los estudiantes.

21. Nanlilimahid ang mga bata sa daan.

22.

23. Håbet om at opnå noget kan give os styrke og energi.

24. Ang mga tao ay nasiyahan sa nangyari.

25. Tengo dolor de garganta. (I have a sore throat.)

26. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

27. Ang Sabado de Gloria ay tahimik

28. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

29. Amning er en vigtig del af den tidlige babypleje.

30. Sa pagtatapos ng seminar, ang mga dumalo ay nag-aapuhap ng mga kopya ng mga presentasyon.

31. Paborito nyang panoorin ang Baby shark sa youtube.

32. Dapat niyo akong pagsilbihan dahil dito.

33. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

34. Superman possesses incredible strength and the ability to fly.

35. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. Mahalagang magbigay ng respeto sa bawat isa, samakatuwid.

38. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

39. Makabalik na nga sa klase! inis na sabi ko.

40. May isa sa mga taong bayan ang nakakita nang isubo ng matanda ang bunga.

41. El teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

42. Ang mahal pala ng iPhone, sobra!

43. But there is a real fear that the world’s reserves for energy sources of petroleum, coal, and hydel power are gradually being exhausted

44. Inalagaan si Maria ng nanay niya.

45. ¿Dónde vives?

46. Sinong may sabi? hamon niya sa akin.

47. Waring may nais siyang sabihin, ngunit pinili niyang manahimik.

48. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

49. The new factory was built with the acquired assets.

50.

Recent Searches

communitysellsuccessfulpunsorobertratefansrhythmlasingero2001dinalastandpartnertomnahuhumalingnamumulaklaktradisyonmakapaibabawnagngangalangmassestinangkapagpapatubokasiyahangumagamitfranciscopahiramligayanalangmongretirarpakibigayvitaminmerchandiselayuanampliaburolwednesdaymisteryococktailnag-away-awayhappenedmartialnenapisonoblehetolateboyetbeganhanlarryyanhimselfeducationalbridemapakalientryalignskumukuhakayamangingisdangkinauupuanghurtigerepunung-punoalexanderunti-unticultivapaglalaitinilistayumabongmagbantaydatapwatganapinmauupoanumannandiyantagaldailylarongiyakhelpedkaysakulanginomcasabumabahaimaginationmalinisnakasuotniligawanpaghingifeedback,inisgodgamitmumuradidingcirclepagigingchefkategori,limitednagtatrabahonagre-reviewsimbahanlabormakukulaynagpasamagasmeneksport,napakomarilousumpainbumuhostamisupuanbinigyansalitangpinag-aralanhidingchickenpoxpagtutolspecializedgatheringmaranasanelectpaslitnanlilisikconsiderednaghihirappagsasalitatayonapakatagalnag-aalalangmarahilnapakasipaglabing-siyamshiftbulaklakbayawakinterests,tumalonsocialiyamotnaawacountrypangalanankanayangtalentednamumutlakungsidoipinangangakpagkaraanlalakeahhhhmageconomictandangmabaitkumbentoaminincidenceinalalayanorugagivesummitsteercreatingpinapakiramdamanpagkakatayomalawaknogensindepoliticstig-bebentemahahanaypinakabatangemocionantelalakiminamahalyumabangtotoongnareklamoisangsupilinnasaanmadungisyumuyukopinangaralannapakabilisibinaonanumangnapawipaligsahangawasunud-sunodmakisuyotiposumibigkatagang