Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

81 sentences found for "including"

1. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

2. Ailments can impact one's daily life, including their ability to work, socialize, and engage in activities.

3. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

4. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

5. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

6. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

7. Ariana has won numerous awards, including two Grammy Awards, multiple Billboard Music Awards, and MTV Video Music Awards.

8. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

9. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

10. Cancer can affect any part of the body, including the lungs, breasts, colon, skin, and blood.

11. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

12. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

13. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

14. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

15. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

16. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

17. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

18. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

19. Electric cars can be charged using various methods, including home charging stations, public charging stations, and fast charging stations.

20. Football is played with two teams of 11 players each, including one goalkeeper.

21. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

22. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

23. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

24. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

25. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

26. Healthcare providers and hospitals are continually working to improve the hospitalization experience for patients, including enhancing communication, reducing wait times, and increasing patient comfort and satisfaction.

27. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

28. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

29. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

30. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

31. It's important to consider the financial responsibility of owning a pet, including veterinary care and food costs.

32. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

33. Lazada offers various payment options, including credit card, bank transfer, and cash on delivery.

34. Los Angeles has a vast and efficient public transportation system, including buses, trains, and a subway network.

35. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

36. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

37. Many wives have to juggle multiple responsibilities, including work, childcare, and household chores.

38. Money can take many forms, including cash, bank deposits, and digital currencies.

39. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

40. Nationalism has played a significant role in many historical events, including the two World Wars.

41. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

42. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

43. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

44. Pets, including dogs, can help children develop empathy and responsibility.

45. Scissors are commonly used in various industries, including arts and crafts, sewing, hairdressing, and cooking.

46. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

47. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

48. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

49. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

50. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

51. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

52. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

53. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

54. The concert raised funds for charitable causes, including education and healthcare.

55. The crown jewels, including the king's crown, sceptre, and orb, are symbols of royal authority and power.

56. The discovery of cheating can lead to a range of emotions, including anger, sadness, and betrayal.

57. The garden boasts a variety of flowers, including roses and lilies.

58. The grocery store offers a variety of fresh produce, including fruits and vegetables.

59. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

60. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

61. The team has had several legendary coaches, including Phil Jackson, who led the Lakers to multiple championships during the 2000s.

62. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

63. The United States has a long-standing relationship with many countries around the world, including allies such as Canada and the United Kingdom.

64. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

65. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

66. The United States has been involved in many international conflicts, including World War I and World War II.

67. The United States is a global leader in scientific research and development, including in fields such as medicine and space exploration.

68. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

69. The United States is known for its entertainment industry, including Hollywood movies and Broadway shows.

70. The zoo houses a variety of animals, including lions, elephants, and giraffes.

71. There are many different types of microscopes, including optical, electron, and confocal microscopes.

72. This was followed by a string of hit songs, including Blue Suede Shoes, Hound Dog and Heartbreak Hotel

73. Trump implemented various policies during his tenure, including tax cuts, deregulation efforts, and immigration reforms.

74. Trump's administration faced scrutiny and investigations, including the impeachment process in 2019 and 2021.

75. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

76. Users can create and customize their profile on Twitter, including a profile picture and bio.

77. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

78. Women have been subject to violence and abuse, including domestic violence and sexual assault.

79. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

80. Women have faced discrimination and barriers in many areas of life, including education and employment.

81. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Overcoming challenges requires dedication, resilience, and a never-give-up attitude.

2. The uncertainty of the situation has made it difficult to make decisions.

3. Puwedeng gamitin ang pagguhit upang mag-disenyo ng mga damit at mga bagay-bagay.

4. Siya ang nagpatuloy sa pag-aagwador.

5. Aquaman has superhuman strength and the ability to communicate with marine life.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

7. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

8. You can always revise and edit later

9. Mi novia y yo celebramos el Día de los Enamorados con una tarde de películas románticas en casa.

10. The pretty lady walking down the street caught my attention.

11. They do not eat meat.

12. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

13. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

14. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

15. The decision to release the product early was a risky but ultimately successful strategy.

16. The acquired assets will improve the company's financial performance.

17. This shows how dangerous the habit of smoking cigarettes is

18. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

19. Argh. Parang batang bading naman eh. Anubayan.

20. Alas-tres kinse na ng hapon.

21. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

22. Magbabakasyon kami sa Banawe sa tag-araw.

23. Las aplicaciones móviles permiten el acceso a internet desde cualquier lugar.

24. Ang punong-kahoy ay isa sa mga kinakatigan ng mga environmentalist sa pangangalaga ng kalikasan.

25. Binili ko ang sapatos dahil sa kanyang magandang disenyo, bagkus ito ay hindi gaanong komportable isuot.

26. She was excited about the free trial, but I warned her that there's no such thing as a free lunch.

27. Emphasis can help to ensure that a message is received and understood by the intended audience.

28. Beth ang pangalan ng matalik kong kaibigan.

29. Pasensya na, hindi kita maalala.

30. Ang mga hanging taniman ng mga orchid ay gumagawa ng isang maganda at mayabong na tanawin.

31. No hay mal que por bien no venga. - Every cloud has a silver lining.

32. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

33. La tormenta produjo daños significativos en la infraestructura de la ciudad.

34. Fødslen kan være en tid med stor stress og angst, især hvis der er komplikationer.

35. Kings may wield absolute or constitutional power depending on their country's system of government.

36. Oo na nga, maganda ka na. Bagay sayo.

37. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

38. Ang kanyang hinagpis ay nakikita sa kanyang mga mata, kahit hindi niya ito binibigkas.

39. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

40. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

41. The store was closed, and therefore we had to come back later.

42. Ang kakahuyan sa paligid ng aming tahanan ay nagbibigay ng kahanga-hangang mga tanawin sa tuwing taglagas.

43. Kung mababatid lang ng mga tagaroon ang katotohanan, marahil hindi na sila magtataka kung bakit namumukod-tangi ang kagandahan nina Lala, Dada at Sasa.

44. There are a lot of amazing destinations to explore around the world.

45. TikTok is a social media platform that allows users to create and share short-form videos.

46. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

47. Claro que puedo acompañarte al concierto, me encantaría.

48. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

49. Alam niyang maganda talaga ang dalaga at hindi totoo ang sinabi niya.

50. Wer den Schaden hat, braucht für den Spott nicht zu sorgen.

Recent Searches

includingkailancarrieslagnattanggalinsinasabimagitingkababaihanbuhayakonanaisinnandoondinukotdahilanbahaygumagawadinibodaibafuncionarsumalaunibersidadtaingapakainsumusunodmaaarinagbantaytextopinahalatamakahihigitmetodiskprovidedkelanbumisitaaparadorhubadpinggansinghalbeintehigaclimabansangbiyernespagsasalitaanaksisterherramientapagbilinvasquespaparamifarmcaracterizakalawakanwednesdaymensajesvidenskabrepublicsurroundingskinatitirikantuladkahonpinangalanangipinadakipmaasahannamanmalamigtumabiprotestatuwingtiketshopeesandokpinangaralanpatuloypamangkinpagsisisipagka-diwatapaghalakhaknoongnasabingnasabinamingnakitamakabangonnakabilinagtagponagbigaynagbibigaynagbabakasyonmawawalaospitalmasaganangmaratingmakikitulogpawiinbugbuginmagtataposmusicmagingmag-aaralmaayoskongkinakitaankinakailangangkarapatangkangitankamaomangyayarikalagayandalirismokerrelyhabitsmusmossusnakahiganggabinapupuntacampnagdaanpangulotekstjackzitinataghinatransmitidaswestinasikasoilagayibangkagabihimihiyawhimigfridayexampledoondisenyodisensyodalawaboyfriendbirdsanomgaanimadalasandoyeskuwelabinilinayonedadnahuhumalinglalakisino-sinomalakassinasimplenghanginkahoyangkanrumaragasangsaleganunnicolasarbejdertrapikjuniomaghintaykargangkababalaghangbagal1929tatagalvillagehongvideosespanyoldraft:rosariopumupuriestablishnagdiriwangpedroshoespaghusayantilpinaghihiwanangingitngitneedkaratulangisinumpaiginawadagaddagokpersistent,natagalanmayamangpagkakataonnakapikitbata