Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "inintay"

1. Oh gosh. Inintay pa sya ng prince, what does it mean?

Random Sentences

1. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

2. Comer saludable es una forma importante de cuidar tu cuerpo y mejorar tu calidad de vida.

3. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

4. Mahirap makita ang liwanag sa gitna ng mailap na kadiliman.

5. Omelettes are a popular choice for those following a low-carb or high-protein diet.

6. Natutuwa ako sa balitang iyan mahal ko.

7. Some limitations can be temporary, while others may be permanent.

8. They have bought a new house.

9. All these years, I have been grateful for the journey and excited for what the future holds.

10. Pagkatapos kong maglaba ay pupunta na ako sa mall.

11. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

12. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

13. Huh? Anong wala pa? nagtatakang tanong ko.

14. Ipinagbabawal ang paglapastangan sa mga pampublikong lugar tulad ng mga museo at bibliyoteka.

15. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

16. Therefore, we should all steer clear of this bad habit of smoking cigarettes

17. Ang mga ideya ni Rizal tungkol sa pagkakapantay-pantay, edukasyon, at pagkakaisa ay patuloy na nagbibigay-inspirasyon sa mga Pilipino.

18. Hockey referees are responsible for enforcing the rules of the game and ensuring player safety.

19. Tumakbo na ako para mahabol ko si Athena.

20. Las redes sociales son una plataforma para compartir fotos y videos.

21. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

22. Ihahatid ako ng van sa airport.

23. He was warned not to burn bridges with his current company before accepting a new job offer.

24. Selamat pagi, bagaimana kabar Anda? - Good morning, how are you?

25. Sa aming pagsasaliksik, nagkaroon kami ng maraming mungkahi upang mapabuti ang aming eksperimento.

26. Nagliliyab ang apoy sa kagubatan, kaya't mabilis na kumalat ang sunog.

27. Durante el trabajo de parto, las contracciones uterinas se hacen más fuertes y regulares para ayudar al bebé a salir.

28. Marami ang nahuhumaling sa larong mobile legends.

29. We have been walking for hours.

30. La falta de vivienda adecuada y segura es un problema común para las personas pobres.

31. Ada juga tradisi memotong tali pusar setelah kelahiran, yang dianggap sebagai tindakan penting untuk menjaga kesehatan bayi.

32. Børn skal have mulighed for at udforske og lære om verden omkring dem.

33. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

34. Hindi umimik si Aling Marta habang minamasdan ang bata.

35. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

36. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

37. Ang mga pulis nagsisilbi upang mapanatili ang kaayusan at kapayapaan sa komunidad.

38. The momentum of the car increased as it went downhill.

39. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

40. Nanalo siya ng award noong 2001.

41. The executive branch, represented by the President of the United States, is responsible for enforcing laws

42. Mas maganda ang ambiance sa dapit-hapon kaysa sa ibang oras ng araw.

43. Ang pagtangkilik ng musika o pagtugtog ng isang instrumento ay isang nakagagamot na karanasan na nagbibigay ng ligaya sa aking puso.

44. Forgiveness allows us to let go of the pain and move forward with our lives.

45. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

46. He blew out the candles on his birthday cake and made a wish.

47. Nahihilo ako dahil masyadong maalog ang van.

48. Tengo vómitos. (I'm vomiting.)

49. Min erfaring har lært mig, at tålmodighed er en dyd.

50. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

Similar Words

hinintay

Recent Searches

reynainintaykinatondomarilousinanochebulonginastamahalinnapatawadmininimizeaumentarmalambingbotantetrendangerouslandibinalitangosakapatunayankinsestoimagesmagigitingmataraykindssalatkinantamaibalikninongmatabangmatapangknightkatapatrisenoonfeltbusyangkamatissabihingsumabogdalawparagraphsimportantesilogjudicialramdamgamotlordsufferkerblaryngitistaingasipapanayeuphorickwebabatokmangingisdapalagitransmitidastiketnagsusulputanpulaphysicaluncheckedsamudevelopedsorrysuelosteveitinaliboksingotrashallpersonaleeeehhhhglobalmegetdilimsubjectbatipitakaoliviaspecialnilinismayopoothindetypeipinalititinuringinteriorfrogmakapilingtutorialsferreramazonstuffedfacilitatingflashfarspaghettivieweditorharmfulcomunesbridesofapapuntapaastrategyworryjamesdragonfindpitongpinagmamasdanmagulayawmagtiwalamagagawamahuhusayhumiwalaybalitanawawalainasikasoniyogmalambotkahuluganpioneerpangungusapnamataytumatawagsinasakyanmakikiligoumiinomi-rechargepagtingingumantinagwagiricanareklamohulupagsahodlalakadkumakantamakukulaytumunogkaninumano-onlinekamiasyumuyukopaglalabakomedorlabinsiyamna-fundnaghihiraprevolutioneretrespektivemamalasnagpalutotungkodnapuyatnanunurimaintindihanpinigilanyumaomagtataniminiresetatienennanamannaguusaptsismosarenacentistabulalaskatolisismolumindoltumatakbodiinmusicalesmarasiganmadungislot,kapintasangtinataluntonmanirahansandwichpakilagaypadalashabitsnagbibigayanpantalongnaantigtahimikbefolkningentuyoparusahanpalamutimahigpit