Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "interact"

1. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

4. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

5. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Si Hidilyn Diaz ay ang unang Pilipinong nakapag-uwi ng gintong medalya mula sa Olympics.

2. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

3. Pinaliguan ni Simon ang sanggol.

4. Isang araw, habang nangangahoy si Mang Kandoy, nakakita ito ng isang kweba sa gitna ng kagubatan.

5. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

6. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

7. Mayroong dalawang libro ang estudyante.

8. Pumasok ang mga estudyante sa klase nang limahan.

9. Talaga? aniya. Tumango ako. Yehey! The best ka talaga!

10. Electric cars can support renewable energy sources such as solar and wind power by using electricity from these sources to charge the vehicle.

11. Maaaring magdulot ng pangmatagalang epekto sa kalusugan at kaligtasan ng mga tao ang digmaan.

12. El coche deportivo que acaba de pasar está llamando la atención de muchos conductores.

13. Sa digmaan, ang militar ang pinakamahalagang sangay ng pamahalaan.

14. The damage done to the environment by human activity is immeasurable.

15. Saka dalawang hotdog na rin Miss. si Maico.

16. Pwede ba Maico, wala kang pakealam! singhal ko sa kanya.

17. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

18. Las heridas punzantes, como las causadas por clavos o agujas, pueden ser peligrosas debido al riesgo de infección.

19. Television also allowed for the creation of a new form of entertainment, the television show

20. Nagtanim ng puno ang mga boluntaryo nang limahan.

21. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

22. Ang carbon dioxide ay ina-absorve ng mga puno.

23. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

24. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

25. Inutusan ng guro ang mga estudyante na ipunin ang lahat ng bola sa silid.

26. Las redes sociales son una parte fundamental de la cultura digital actual.

27. El amanecer en la montaña es un momento sublime que nos conecta con la naturaleza.

28. It's crucial to pay off your credit card balance in full each month to avoid interest charges.

29. Lapat na lapat sa kanya ang kamisetang iyon noong bagong bili ngunit ngayo'y maluwag na.

30. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

31. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

32. Doctor Strange is a sorcerer who can manipulate magic and traverse different dimensions.

33. Pinaluto ko ang adobo sa nanay ko.

34. Hindi tayo sigurado/nakatitiyak.

35. El autorretrato es un género popular en la pintura.

36. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

37. Dahan-dahang naglayag palayo ang bangka mula sa pampang.

38. Inakalang magugustuhan ng lahat ang ideya niya, pero tinanggihan ito.

39. Aling telebisyon ang nasa kusina?

40. Hindi nawawala ang halaga ng panitikan sa pagpapalaganap ng kultura at kaalaman, kaya't ito ay mahalaga sa buhay ng mga tao.

41. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

42. Ano ang pinag-aaralan ni Cora?

43. Microscope lenses must be kept clean and free of debris to avoid distortion and other imaging problems.

44. A caballo regalado no se le mira el dentado.

45. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

46. Magsusunuran nang manukso ang iba pang agwador.

47. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

48. Paboritong laro ng kuya ko ang basketbol.

49. At være ærlig over for os selv og andre er vigtigt for en sund samvittighed.

50. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

Recent Searches

edit:interactinaapitechnologiesconditionrobertconstitutionfourisipannananaloretirartinderaangheljocelynlargelumakingtabingcongratsmakisignapadungawsulyapmantikaconventionalnagdabogconstantlybighanieditpagtatakakarnabalresumenmagsi-skiingmakauuwinahulogbaonapamakikipagbabagplantasmightpinag-aralandilagsentimosgiraysafermakikikainoutlinesingeribabanaroonprivatefansmapakaliimportanttwinklebornumigtadnagkakatipun-tiponagwadornakaramdamnanghahapdimagkasintahansundhedspleje,upuankatawangnagtagisannakumbinsipagpasensyahannagpipiknikpapagalitansabadongnalalabiiphonemahihirapkahariankabundukankumakapalpinabayaanpaglalabadaiwinasiwasnasisiyahanmatalinonakatapatbumahaninanaispaglapastanganexhaustionmahahalikpambatangmagpagupitmagturokumikilosmedisinadistanciaharapanenviarisinagotnakahainyumabanglumibotpamumunoiniindabumaligtadpaulit-ulitkristojosiehonestolungsodkuripotpaninigaspakukuluanhiniritnahahalinhankawawangchristmasginoongibabawinhalelever,valiosapalantandaansasapakinumaasahastayoutubeisinumpaasawanapapatinginnapilitangrequierenmawalaipinansasahogahastssstinikiniibiguntimelyantoksisidlantulalamakinangtatawaganknowsiconicpriestpepeparangeducationinatakemalumbaybuenaangkancomputerdietnoopinatidmario00amtapattumangobarrocotinanggaphalalanpakelamcommissionspeechesaywannagdaramdamginangkerbbroadcastbossmillionsproducirhumanobinabalikbiliscalambastevesobraerapculturesakoasignaturaalinmovingwouldfacegrabefacultylockdownauthorpdaexplaincertainclockdevelopservicesinterviewingbilingspreadeither