Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "interact"

1. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

2. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

3. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

4. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

5. Twitter is a popular social media platform that allows users to share and interact through short messages called tweets.

Random Sentences

1. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

2. Morgenstund hat Gold im Mund.

3. Nariyan sa kahon ang kamiseta mo.

4. Seeing a favorite band perform live can create a sense of euphoria and excitement.

5. La creatividad nos permite expresarnos de manera única y personal.

6. Writing a book is a long process and requires a lot of dedication and hard work

7.

8. Magkapareho ang kulay ng mga bag namin.

9. Nasaan ang Katedral ng Maynila?

10. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

11. Les thérapies alternatives telles que l'acupuncture et la méditation peuvent aider à réduire le stress et améliorer la santé mentale.

12. Ang Biyernes Santo ay pagluluksa.

13. Payat at matangkad si Maria.

14. I love you so much.

15. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

16. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

17. Limitations can be overcome through perseverance, determination, and resourcefulness.

18. Es importante que los gobiernos tomen medidas para ayudar a las personas pobres.

19. Nagbabaga ang usapan ng mga opisyal sa harap ng media dahil sa kontrobersiya.

20. Hiram lamang natin ang ating buhay sa Diyos.

21. Ang mga bata ay masayang lumibot sa hardin, nakikipaglaro sa mga kaibigan.

22. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

23. Eto namang si Kuya di na mabiro! Bagay na bagay kaya kayo!

24. Bumili ako ng bagong set ng kubyertos para sa aming bahay.

25. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

26. The momentum of the ball was enough to break the window.

27. The police were trying to determine the culprit behind the burglary.

28. Hindi malaman kung saan nagsuot.

29. The zoo houses a variety of animals, including lions, elephants, and giraffes.

30. Ano ang nasa bag ni Cynthia?

31. I can't believe how hard it's raining outside - it's really raining cats and dogs!

32. Emphasis can help to ensure that a message is received and understood by the intended audience.

33. Nosotros decoramos el árbol de Navidad juntos como familia durante las vacaciones.

34. Pahiram ng iyong mga notepads at ballpen para sa aking meeting.

35. Ihahatid ako ng van sa airport.

36. Magkano ang halaga ng bawat isang blusa?

37. Teka, pakainin na muna natin sila. ani Jace.

38. It was risky to climb the mountain during a thunderstorm.

39. They organized a marathon, with all proceeds going to charitable causes.

40. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

41. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

42. Hun er min store forelskelse. (She's my big crush.)

43. Les travailleurs peuvent travailler dans des environnements différents, comme les bureaux ou les usines.

44. The movie was rated R, and therefore she wasn't allowed to watch it.

45. Hay muchas hojas en el jardín después de la tormenta.

46. Natalo ang soccer team namin.

47. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

48. Ang galing nya maglaro ng mobile legends.

49. We have completed the project on time.

50. Sa pagkakaroon ng pagkakamali, hindi maiwasang maglabas ng malalim na himutok.

Recent Searches

evolveinformedyeahinteractroughmitigatefutureberkeleyedit:makesreadtoolconsiderpackagingryanbetacrazyventauponeachimpactedreleasedrepresentednotebookincreasedparatingtalepinatutunayanpapuntapdaauthorkolehiyovidenskabtigasgandabrindardoktorbabesisinalangnagpaiyakfollowing,nageespadahanpointmahinanagagamitpagkasabiinaabotnatabunanproducererniyogbirthdaydescargarobservation,gasmendisciplin1960stawanantalagaenergiiniibigtoypuwedeplasahinogtracknakakatawascientistmapadalirhythmochandoelectedallowshighestmawalaclassesmaptablefalldenpollutionplaysfindngpuntailanprivateoutcondopangulonaritoespadadaanitinalicomplicatedresearchkitangipinikitpowermurangcafeterialabingloriroboticsumugodglobalfrachoiceflexiblenakakatulonggabi-gabinakapagreklamoadvertising,ikinabubuhaynagagandahanpagluluksamagkikitadistansyapagkakatayonagsusulatnanghahapdipinakamahalagangnakaliliyongmakalaglag-pantykikitanagtuturokalayaanmeriendanapaluhavirksomhederpagkakalutomagasawangpagngitipaga-alalahinipan-hipanmerlindaisinulatmagpaniwalagayunmanpangungutyaanibersaryopinapakiramdamanmaglalakadsalamangkerotinulak-tulakmagpa-checkupnamumuongnakagalawhumalakhaknaguguluhanpagkagustonalugmokmangkukulamkumikilospagpanhiknegro-slavesnaiyaknagreklamoentrancepaghihingalomakidalomagpakasalmakasilongiwinasiwasinvestingmagpagalingnagpepekenagnakawmahiwagangrevolutioneretpagdukwangnagpatuloybloggers,jobsnahawakanpagkaimpaktopinahalatakamiasninanaissundalokomedortv-showstutungogumawamasasayakalabawhoneymoonumuwiseguridadnaglokototoongpandidirihayaantinakasanmontrealnakakatandapinasalamatannasiyahanreplacednaiilagannagcurvekamakailan