Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "resources"

1. A lot of people volunteer their time and resources to help those in need.

2. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

4. Investing refers to the process of allocating resources with the expectation of generating a profit.

5. Limitations can be a result of geographic location or access to resources and opportunities.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Recycling and reducing waste are important ways to protect the environment and conserve resources.

9. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

10. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. The project was behind schedule, and therefore extra resources were allocated.

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

14. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Nagtawanan ang mga kaibigan, waring may alam silang lihim na hindi ko nalalaman.

2. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

3. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

4. Le sommeil est également essentiel pour maintenir une bonne santé mentale et physique.

5. The argument was really just a storm in a teacup - it wasn't worth getting upset over.

6. The Lakers have retired numerous jersey numbers in honor of their legendary players, including numbers 8 and 24, worn by Kobe Bryant.

7. Lalong nagalit ang binatilyong apo.

8. There's no place like home.

9. Beast. sabi ko pagkalapit sa kanya.

10. Hinugot niya ang kanyang kaisipan upang makaisip ng magandang solusyon sa problema.

11. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

12. Ang tag-ulan ay kadalasang panahon ng pagtatanim ng mga halaman at tanim dahil sa malakas na pag-ulan.

13. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

14. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

15. Ang panayam sa radyo ay ukol kay Doktor Jose Rizal na tumulong sa mahihirap.

16. Bakit niya gustong magpahaba ng buhok?

17. Nasa kanluran ang Negros Occidental.

18. Ang talambuhay ni Gregorio del Pilar ay nagpapakita ng kanyang katapangan sa laban para sa kalayaan ng bansa.

19. Mathematics can be both challenging and rewarding to learn and apply.

20. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa, tulad ng mga makata at nobelista.

21. Si Rizal ay nagbigay-inspirasyon sa maraming Pilipino na magkaroon ng katapangan at determinasyon sa kanilang pakikipaglaban para sa pagbabago at katarungan.

22. Nagtawanan kaming lahat sa hinirit ni Kenji.

23. Mabuti na lamang at hindi natuloy ang sumpa.

24. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

25. Nakakalasing pala ang wine pag napasobra.

26.

27. Paboritong laro ng kuya ko ang basketbol.

28. L'entourage et le soutien des proches peuvent également être une source de motivation.

29. Narinig ko ang lagaslas ng tubig mula sa shower.

30. Kunwa pa'y binangga mo ko, ano, ha? Magaling, magaling ang sistema ninyong iyan.

31. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

32. Ipinambili niya ng damit ang pera.

33. Don't give up - just hang in there a little longer.

34. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

35. Si Hidilyn Diaz ay nagtayo ng weightlifting gym upang suportahan ang mga susunod na henerasyon ng atletang Pilipino.

36. Frohe Weihnachten! - Merry Christmas!

37. Kape ang iniinom ni Armael sa umaga.

38. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

39. Hindi nag-iingat ang bata kaya siya naaksidente sa kalsada.

40. Bumaba na sila ng bundok matapos ang ilang oras.

41. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

42. Sa gitna ng parke, nahanap namin ang lilim ng malalaking puno na perpekto para sa aming piknik.

43. Durante el trabajo de parto, las contracciones uterinas se hacen más fuertes y regulares para ayudar al bebé a salir.

44. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

45. I am teaching English to my students.

46. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

47. Dahil dito ang mga tao ay laging may mga piging.

48. Viruses have been used in genetic engineering and biotechnology to develop new therapies and treatments.

49. She admires her mentor's leadership skills and work ethic.

50. In recent years, television technology has continued to evolve and improve

Recent Searches

generateplanresourcesinfluentiallorenaareaspaclassroomtracklaslearningautomaticinsteadputingtypescreateinterviewingeitherlibrorelevantuserecentfencingnatutuwatumatawawaributilnangingitngitpamilyangnagmakaawapuwedengpilitadmiredtindigmulingna-curiouspagsusulatfrescometrotilanatapakannaglababaduytuloynakakapasokwriting,programmingmanghikayatnakapagsalitapagmasdankumakalansingsinongkanyaperlanagpagupitpupuntahandesdegratificante,jigsnanghihigitkayamathuniversityipatuloymasasabingunitninanaisasolihimverypetsamunangkarapatangtiningnananaymediamaintindihantangingtumakassisipainmaingayflamencokapatawarananungumibigtatlongsidonapakalilikogawakaninahinahaplosmalakiparkenapatinginnuhmagkasinggandaeducationtamautilizartungokasisweetprimerrailwayspierhehesparetinanggapipaliwanaglendingnaiyaknapakamotmakikikainbestfriendsiniyasatnakuhangturismoeskuwelanagngangalangnakikini-kinitaikinagagalakbatipinabayaannahawakaneskwelahansabadongnanlilimahidmusiciannakaluhodmakapangyarihannamumuongmontrealmakuhangnagtakamedisinanagpabotmangkukulamnapipilitanmagpapagupitpaanongyumuyukonag-uwisumusulatlumamangpaglalabamahiyamensahemedikalpinapataposkontinentengstorypakikipaglabantungkodisinuotthanksgivingvideosmagpahabangumingisihimiglalomalalakikunditumaposnatanongpropesornakakaanimnakapagproposenaaksidentelot,makapalnakatuonmaaksidentetusongvaledictoriannuevosmakisuyotagumpaysteamshipspakibigyanminervietsuperahasnagisingparehasreviewfiverrsilapakisabimatesapanitikankakainsakimdiaperdespuesmagsaingnahulaanalmacenardreams