Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "resources"

1. A lot of people volunteer their time and resources to help those in need.

2. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

4. Investing refers to the process of allocating resources with the expectation of generating a profit.

5. Limitations can be a result of geographic location or access to resources and opportunities.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Recycling and reducing waste are important ways to protect the environment and conserve resources.

9. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

10. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. The project was behind schedule, and therefore extra resources were allocated.

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

14. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Pinakamatipid kong pagkain ay noodles, pero kailangan ko pa rin ng kubyertos.

2. We might be getting a discount, but there's no such thing as a free lunch - we're still paying for it in some way.

3. The officer issued a traffic ticket for speeding.

4. Pangako ng prinsipe kay Mariang maganda.

5. ¿Te gusta el sabor picante del jengibre?

6. Sinong may sabi? hamon niya sa akin.

7. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

8. Dahan-dahang naglayag palayo ang bangka mula sa pampang.

9. Tolong jangan lakukan itu. - Please don't do that.

10. Kaninong payong ang asul na payong?

11. Sa pagdating ng buhawi, ang mga tao ay kailangang mag-ingat at maghanda ng mga emergency kit at planong evacuation.

12. The first mobile phone was developed in 1983, and since then, the technology has continued to improve

13. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

14. Cancer can impact individuals of all ages, races, and genders.

15. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

16. Ang laki-laki ng cardigan na ito.

17. The movie was absolutely captivating from beginning to end.

18. Ang tubig-ulan ay nagbibigay ng mga oportunidad para sa mga aktibidad tulad ng paglalaro sa ulan, pagsusurfing, at iba pa.

19. The app has also been praised for giving a platform to underrepresented voices and marginalized communities.

20. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

21. Ang pagsalungat sa agaw-buhay na sistema ng lipunan ay kailangan upang magkaroon ng tunay na pagbabago.

22. Sa takip-silim, maaari kang mapakali at magpakalma matapos ang isang mahabang araw.

23. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

24. Mahalagang magpakatotoo sa pagpapahayag ng financial status upang maiwasan ang pagkakaroon ng maraming utang.

25. Pa-dayagonal ang pagkakahiwa ko ng hotdog.

26. Tila may lihim siyang itinatago sa atin.

27. Ang paborito niyang laruan ay Beyblade.

28. Kinuskos niya ang kanyang buhok at nabasa pati ang kanyang anit.

29. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

30. Ang daming labahin ni Maria.

31. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

32. Ipaghugas mo siya ng mga Maghugas ka ng mga

33. Pupunta si Trina sa Baguio sa Oktubre.

34. Ano ang pinabili niya sa nanay niya?

35. Maglalaba ako bukas ng umaga.

36. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

37. Si Aguinaldo ay nahuli ng mga Amerikano noong 1901 sa Palanan, Isabela.

38. TikTok has faced controversy over its data privacy policies and potential security risks.

39. Sumigaw siya ng "sandali lang!" ngunit patuloy itong naglakad palayo.

40. Sa pamamagitan ng kalayaan, nakakamit natin ang tunay na pagkatao at kakayahan.

41. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

42. Sigurado ka? Hala! Mag-order ka rin ng burger at fries!

43. Maaaring maging verbal o non-verbal ang hudyat, tulad ng pagtango, pagngiti, o pagsulyap.

44. Ang paglapastangan sa mga bata at kababaihan ay isang malaking suliranin sa lipunan.

45. Gusto nilang sumakay ng dyipni sa Pilipinas.

46. Sa takip-silim, mas nakakapag-relax ang mga tao dahil sa kalmado at malumanay na hangin.

47. Nag merienda kana ba?

48. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

49. They volunteer at the community center.

50. Who needs invitation? Nakapasok na ako.

Recent Searches

nasabilumamangresourcessalitapagbatiayawbalitaidaalisrevisegeneratesapagkatdevicespinag-aaralanwikabringingpaidthumbsperangsahigtelevisionperabitaminaapatreleasedbumotobangladeshibotoskyprogramadiseasenatupadsinasabimovingpisojobspreviouslylegacybasketballpersonalplatformstamangfranciscotokyokaniyanagbatidrawinghansayocanhiponperongayorosassoccertumahanniyangsaan-saanpasasalamatgobernadorkasotumatakboestablisimyentokinakaligligulanhinawakannagsalitapinakamahalagangipinagdiriwangmarvinngamagkanoolapagraranaskampanajohnalasconcernsbilinnakaraangnagbiyahemedidapakikipaglabankinayapopulareleksyonasaeksempelpopularizelawatumikimpaanovigtigstetaondamasosangwakaspayatdahan-dahansinabingricaeconomicsunud-sunuranvelfungerendeunangmatamakulongkayangalpatingnauntognanghihinapramistools,nagpapakainkomunikasyonmagpagalingonlysamakatuwidtenangheltransparentinspiredlotnapakagalingsasayawintatayalesamparoimportantdondehila-agawankasaysayanpanapeacepag-ibigdapataraw-arawprutaskahulugantinagababasahinartemagkakagustopakakatandaanhojasdepartmentbotopansamantalaklasechavitmagkakaila00amnagingnakasunodmakatatlomalabobigotedadalawinculturalnapakaramingpamilyabumugaharap-harapangpinunitnaintindihanlandexviitopicsaranggolakandidatodyannangnag-oorasyonnilimasdoktorbarmirahvordankalikasannilapitansallybuhaydibapresencepacienciapang-isahangwhilesang-ayonsong-writingaplicarisasagotarmedsalarinkalawangingrelypamimilhingmaiingaypay