Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "resources"

1. A lot of people volunteer their time and resources to help those in need.

2. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

4. Investing refers to the process of allocating resources with the expectation of generating a profit.

5. Limitations can be a result of geographic location or access to resources and opportunities.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Recycling and reducing waste are important ways to protect the environment and conserve resources.

9. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

10. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. The project was behind schedule, and therefore extra resources were allocated.

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

14. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. The library has a variety of books to choose from, ranging from classics to modern literature.

2. The detectives were investigating the crime scene to identify the culprit.

3. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

4. Umakyat sa entablado ang mga mang-aawit nang limahan.

5. Las serpientes tienen una lengua bifurcada que utilizan para captar olores y explorar su entorno.

6. Sa kasawiang-palad ay tinamaan ang magkakapatid at agaw-buhay na bumagsak sa tubig.

7. La science environnementale étudie les effets de l'activité humaine sur l'environnement.

8. I have been studying English for two hours.

9. Los héroes inspiran a otros a levantarse y luchar por lo que es correcto.

10. Nakakatakot ang kanilang lugar sapagkat andaming adik.

11. Sa paglutas ng mga palaisipan, mahalaga ang pag-iisip nang malikhain at pagpapakita ng kahusayan sa loob ng isang patlang.

12. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

13. Women make up roughly half of the world's population.

14. Halika, i-recharge natin ang baterya mo.

15. Pakibigay sa akin ang listahan ng mga kailangan nating bilhin sa palengke.

16. "Tuloy po kayo," ani ng matanda sa bisita niyang dumating.

17. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

18. Ang kamalayan sa mga isyu ng karapatang pantao ay nagpapabukas ng pinto sa pagtugon sa mga pangangailangan ng mga mahihirap.

19. Nag-alala ako nang magdidilim na ang paningin ko habang nagmamaneho sa isang maulang gabi.

20. Matagal ang pagluluto ng kare-kare.

21. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

22. Aling bisikleta ang gusto niya?

23. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

24. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

25. La realidad nos enseña lecciones importantes.

26. Many people go to Boracay in the summer.

27. Hanggang sa dulo ng mundo.

28. Mag-ingat sa aso.

29. May nakita akong matandang nag-aalok ng pulotgata sa palengke.

30. Ang pangamba ay isang emosyon na karaniwang nararamdaman ng mga tao kapag mayroong posibilidad ng panganib.

31. Every cloud has a silver lining

32. Ang koponan nila ay mas handa at mas determinado, samakatuwid, sila ang nagwagi sa paligsahan.

33. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

34. Black Widow is a highly skilled spy and martial artist.

35. Tila malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

36. Ang kabanata ay nagbigay ng mahahalagang detalye tungkol sa nakaraan ng pangunahing tauhan.

37. The website's analytics show that the majority of its users are located in North America.

38. He struggled with addiction and personal issues, and his health began to deteriorate in the 1970s

39. Up above the world so high

40. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

41. Anong nangyari sa iyo? Bakit ang tagal mong nawala?

42. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

43. Parang tumigil ang lahat, sumabog na ang mga fireworks...

44. Ano ang gustong bilhin ni Juan?

45. Nagpa-photocopy ng lumang diyaryo

46. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

47. Ipinatawag nila ang mga ito at pinagkasundo.

48. "Ang hindi magmahal sa sariling wika, daig pa ang malansang isda" ay isang bukambibig na nagpapahayag ng pagpapahalaga sa ating sariling wika at kultura.

49. Pinangaralan nila si Tony kung gaano kahalaga ang isang ama

50. Microscopes can be used to study the structure and function of the brain and other organs.

Recent Searches

limitpeterresourcespossibleibabaimagingpinapagulongkapilingprogramaexampleprogressmemorybilhanmakapilinggitanasaffectneedswaiteditlasingactorviewtechnologicalwhichnicenegativepointwouldstreamingechavenandayaaktibistaexhaustionnag-umpisaedit:sinunodadditionkatagalegislationnakahigangenfermedades,lagaslasalamniyonipagpalitsinasabipacienciacoloramendmentsnasuklamkumapitnaglakadtilgangmaabutanpakukuluanpagbabayadmagbaliknapalitangmalungkotrightsdiliginawitannationaljosephlipattutoringtutorialsditotooitakinalagaanligayamaghapongpaparusahanmaghahatidnapapatungoinvestingmaisusuotkabundukanpatakbongbanaliyonsumakaylungsodhitipinikitwindowformspangungutyasino-sinopanghihiyangmuligumagamitumaapawgulangpakibigayeitherpaghangaumiibignilanginterestsopomagitingumilingmansanasadaptabilitycountlesscollectionsstatingdidingnapagodkinapanayammagbayadpokerlilimkahaponnagnakawcruzharapanhampaslupanakangisimangkukulampagtataasmasaksihanmabagalgarbansosinstrumentalalaalalaamangligaligtaga-hiroshimareynapantheonjennymahihirapsitawmaliitmayroongnasabotanteknightconsistnakakatandaexpeditedmarietomorrowdisciplinsirabayangpalitannangingitngitbibilhinpagpalitsasapakinunconstitutionalmalalakikalarolumiitgagamittog,nabasarestaurantbinabaratasahanunossahodkumainbinawianpagsidlangroceryitinaassampunglistahanmangingibiglayawsinakopamericanraciallarangantasatagaroonsobraasulkaraokedisposalgoshmunatarcilalumikhakalakihanmakatawaarawisusuotpinagkaloobannakakunot-noongnamumukod-tangikayang-kayangnanghihinanaguguluhangpagkakayakap