Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "resources"

1. A lot of people volunteer their time and resources to help those in need.

2. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

4. Investing refers to the process of allocating resources with the expectation of generating a profit.

5. Limitations can be a result of geographic location or access to resources and opportunities.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Recycling and reducing waste are important ways to protect the environment and conserve resources.

9. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

10. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. The project was behind schedule, and therefore extra resources were allocated.

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

14. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

2. Las drogas pueden tener efectos devastadores en la vida de las personas.

3. La paciencia nos ayuda a controlar nuestras emociones.

4. I rarely take a day off work, but once in a blue moon, I'll take a mental health day to recharge my batteries.

5. Di mana bumi dipijak, di situ langit dijunjung.

6. She has been learning French for six months.

7. Con permiso ¿Puedo pasar?

8. May mga punong-kahoy na nagiging sentro ng mga turista dahil sa kanilang napakalaking sukat at ganda.

9. Ang mga batikang mang-aawit at musikero ay karaniwang itinuturing bilang mga alamat sa larangan ng musika.

10. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

11. Who needs invitation? Nakapasok na ako.

12. Ano ang pinapakinggan mo sa radyo?

13. The website's search function is very effective, making it easy to find the information you need.

14. Ano pa ho ang kailangan kong gawin?

15. Nangangaral na naman.

16. Sa Pilipinas, ang tag-ulan ay kadalasang nagsisimula mula Hunyo hanggang Nobyembre.

17. Omelettes are a popular choice for those following a low-carb or high-protein diet.

18. All these years, I have been making mistakes and learning from them.

19. Hinugot ko ang papel sa loob ng envelope.

20. May nadama siyang ginhawa ngunit pansamantala lamang iyon.

21. Ang aking kabiyak ay ang aking katuwang sa buhay, nagbibigay ng tulong at suporta sa bawat yugto ng aming paglalakbay.

22. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

23. Lahat ng tao, bata man o matanda, lalake at babae, ay tumaba.

24. Ein Bild sagt mehr als tausend Worte.

25. El arte puede ser interpretado de diferentes maneras por diferentes personas.

26. Baby fever can also be influenced by societal and cultural norms, as well as personal experiences and values.

27. Ito rin ang parusang ipinataw ng di binyagang datu sa paring Katoliko.

28. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

29. Ang ganda naman ng bago mong cellphone.

30. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

31. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

32. Wedding planning can be a stressful but exciting time for the couple and their families.

33. Mathematics is an essential tool for understanding and shaping the world around us.

34. The beach has a variety of water sports available, from surfing to kayaking.

35. Mahalaga na tuparin natin ang ating mga pangarap upang hindi natin pagsisihan sa hinaharap.

36. The Tesla Supercharger network provides fast charging infrastructure for Tesla owners, allowing them to travel long distances with ease.

37. Aksidente naming nabasag ang isang plato habang naglilinis ng kusina.

38. Some people view money as a measure of success and achievement, while others prioritize other values.

39. Nais sanang magbago ng isip si Magda, ngunit nanaig ang kanyang pagkagusto kay Damaso.

40. I have been swimming for an hour.

41. Hindi ako sang-ayon sa pagtrato ng ibang mga tao sa kanilang mga kapwa.

42. Sa aming mga tagumpay, nagbabahagi kami ng kaligayahan bilang magkabilang kabiyak.

43. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

44. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

45. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

46. Nagbuntong hininga sya, Akala ko naman.

47. El arte puede ser utilizado para fines políticos o sociales.

48. ¡Feliz aniversario!

49. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

50. Hindi sang ayon si Magda sa mga sinabi ni Mariel.

Recent Searches

resourcesrebolusyonsedentarygraduallyuugod-ugodsyncuugud-ugodbwisitnangwritingcuredstocksreorganizingmanualsusunodinsidentelalolabismarkedsekonomisay,inintaypusasugalestossumapitkapamilyadreamsprincipalesipinikitibinaoncableanolearnspecialmalumbayayudanagkatinginanknowsnabitawanpagkakalutoculturanagkaganitokumukulopagkamanghasurgeryyoutube,tuloy-tuloyshipkamandaglugarnakilalanenamag-aaralhulumagandang-magandacontinuestsismosamagwawalasambitparurusahaninstrumentallaamangbinyagangniconakakaalamfurakinsitawnagbibigayanlayout,taxilatestmaaaritatawaganobservation,nagmamadalihistoriahumiwalayyeypanunuksonanigaspawiinredesonlynanlakicampaignspinapataposbingbingplanning,miyerkulesmeaninggagawinricainsektongpakanta-kantangfitnesspinagmamalakishopeesoccersementotonightmag-galasalatinbuhawianamakapangyarihangawardilawoftemagta-trabahokumalatmantikawindowsinagotstonehampambatangbeintehawaiikasakithumpaymagtigilnapaiyakipinagdiriwangnag-away-awaydoble-karabalemagpasalamattaglagasnatinagunanebidensyanasasalinangovernorsgamitinsahigdaigdignapakagandanglalabhandollyjagiyakamipootsinipangmagdamaganalbularyonagkwentokargahanpayapangsuccessfulmagkapatidkontinentengusingmahihirapexplainuntimelyfallrangebroadcastdrivermovingnakatirapasensyananlalambotpabalangdrayberbiroumakbaytsakanasaannakakagalapetsacolorhumabilalargatugonbinawiankahitbinabasumamaitinaobhalinglingkasalibontagaroondiscoveredtagalogtutungoinakalajuegoseitherminamasdansumagotnagsisihanfeedbackaccuracylintaadditionallypabilipopularizelend