Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "resources"

1. A lot of people volunteer their time and resources to help those in need.

2. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

4. Investing refers to the process of allocating resources with the expectation of generating a profit.

5. Limitations can be a result of geographic location or access to resources and opportunities.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Recycling and reducing waste are important ways to protect the environment and conserve resources.

9. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

10. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. The project was behind schedule, and therefore extra resources were allocated.

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

14. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Taon-taon ako pumupunta sa Pilipinas.

2. Napangiti ako bigla. Yun lang ba yung problema niya?

3. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

4. Bakit ka tumakbo papunta dito?

5. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

6. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

7. Sa droga, walang nagwawagi kundi ang tao mismo.

8. El nacimiento de un bebé es un momento de felicidad compartida con familiares y amigos.

9. Pedro at Juan ang mga pangalan namin.

10. Tinanggap niya ang lahat ng ito at marami pang iba sa kaniyang kaarawan.

11. Ang COVID-19 ay laganap sa buong mundo.

12. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

13. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

14. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

15. Maaliwalas ang panahon kaya itinuloy namin ang piknik.

16. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

17. Natutuwa ako sa balitang iyan mahal ko.

18. Pinakain ni Fia ang aso ng dog treats.

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Have we missed the deadline?

21. Madalas na naglulusak sa dumi ang mga bakuran.

22. Lumaking masayahin si Rabona.

23. My birthday falls on a public holiday this year.

24. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

25. Kinuha naman nya yung isang bote dun sa lamesa kaso.

26. I have been learning to play the piano for six months.

27. Hanggang sa dulo ng mundo.

28. Born in San Francisco in 1940, Lee was raised in Hong Kong and began training in martial arts at a young age

29. Sa tindi ng init, pakiramdam ko’y nagbabaga na ang lupa sa ilalim ng aking mga paa.

30. Les personnes âgées peuvent avoir des difficultés à se déplacer ou à effectuer des tâches quotidiennes.

31. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

32. Ganid na sa pera ang mga taong nakaupo sa pwesto.

33. Einstein's writings on politics and social justice have also had a lasting impact on many people.

34. Ang daming pulubi sa maynila.

35. Taking unapproved medication can be risky to your health.

36. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

37. The Parthenon in Athens is a marvel and one of the most famous wonders of classical Greek architecture.

38. Mahalaga rin ang pagkakaroon ng malawak na kaalaman at kakayahan sa pagpapasya upang malutas ang mga palaisipan sa buhay.

39. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

40. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

41. Hindi sang ayon si Magda sa mga sinabi ni Mariel.

42. May problema ka ba? Kanina ka pa tulala eh..

43. Ang mga anak-pawis ay nagtatrabaho sa ilalim ng mahihirap na kondisyon at kailangan ng agarang solusyon sa kanilang mga pangangailangan.

44.

45. El flamenco es un género musical y de danza tradicional de Andalucía, con raíces gitanas, que se caracteriza por su intensidad emocional y su riqueza rítmica

46. Nagtatrabaho ako tuwing Martes.

47. Some viruses can cause cancer, such as human papillomavirus (HPV) and hepatitis B and C.

48. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

49. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

50. Today, mobile phones have become an essential part of everyday life, and they have greatly expanded the capabilities of the telephone

Recent Searches

resourcesfinishedadventdidingeyepersonsenchanteddoingcuandoclockulingstartedmonitorrefyeahneverallowsmultocontrolledconectadosfeedbackdiretsokinatatakutannalalaglagvictoriafotospamburaerlindatumawagimagingpinapasayapaglisangagawinmovietinutoptumutubonagpagupitnanunuksodisfrutarberegningerpatakbomagbigayhumarapnakauslingsumasayawpaakyatkanilalagaslasmagdilimkulisapbulongeducationgodtutilizasyabernardotrafficpocahis18thprospersatisfactionlcdinuminfeelinglibagclearjunjunmagkasintahantaasnagsisigawpamanhikanpahahanapnananaghilisupremesasamahanexigentepagkatakottumalonrollmasasayamaunawaantaxinatatawanasunogvaledictoriankauntidealagilainspiredisyembrebukassaidsalaringinangdoktorauthorproducireranmakasarilingcontinuedbetweenspiritualnapatawagnegosyantenagtatamponaglalakadtaonisasabadpaanongmahiwaganami-misskulungandistanciapamagatnaaksidentenahahalinhanhagdanannasagutanculturesreboundtarangkahan,steamshipspapalapitbooksplagastrajetinitirhaniwasanalaalacassandrahiningipalapitbaodipangcomunicanmorenabuntistapatahitsystematiskoueexammalinisjosemalabolinegotmatagalnaminrosariotumawanakasahodnagkakakainpatutunguhannagmakaawanakumbinsitravelernakalagaytinulak-tulakvideos,magsasalitawalkie-talkienagkakatipun-tiponhampaslupapagkalitonag-poutinvesting:imporkumaliwanaghuhumindigtagtuyotpagkabuhaynagpepekemagpakasaltinawagairportmaisusuotdiwatamanatilimagpagupitseguridadnakakarinigibinibigaybeautyinaaminpuntahanvidenskabdropshipping,butikimagturomagkasakitmagtatanimkinumutannagdadasalpasyentesalbahengdalawangpakakasalanmasahol