Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

14 sentences found for "resources"

1. A lot of people volunteer their time and resources to help those in need.

2. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

3. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

4. Investing refers to the process of allocating resources with the expectation of generating a profit.

5. Limitations can be a result of geographic location or access to resources and opportunities.

6. Limitations can be financial, such as a lack of resources to pursue education or travel.

7. Protecting the environment involves preserving natural resources and reducing waste.

8. Recycling and reducing waste are important ways to protect the environment and conserve resources.

9. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

10. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

11. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

12. The project was behind schedule, and therefore extra resources were allocated.

13. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

14. There are many ways to make money online, and the specific strategy you choose will depend on your skills, interests, and resources

Random Sentences

1. Pag-ibig na palaisipan, sa kanta na lang idaraan

2. Bawal magpakalat ng mga pornograpikong materyal dahil ito ay labag sa batas.

3. Ang tamis ng pulotgata ay nagbibigay sa akin ng energy para magpatuloy sa araw.

4. Nationalism can also lead to a sense of resentment and hostility towards outsiders.

5. Pang-isahang kuwarto ang gusto niya.

6. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

7. Limitations can be addressed through education, advocacy, and policy changes.

8. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

9. I caught my boyfriend staring at a picture of a pretty lady on his phone.

10. Politics in America refers to the political system and processes that take place in the United States of America

11. They have been renovating their house for months.

12. Muchas escuelas ofrecen clases de música y hay numerosas instituciones educativas especializadas en música, como conservatorios y escuelas de música

13. Ang talambuhay ni Gregorio del Pilar ay nagpapakita ng kanyang katapangan sa laban para sa kalayaan ng bansa.

14. Nakatayo ang lalaking nakapayong.

15. Transkønnede personer har ret til at udtrykke deres kønsidentitet uden frygt for vold eller diskrimination.

16. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

17. I'm going through a lot of stress at work, but I'm just trying to hang in there.

18. Pinaliguan ng malamig na tubig ang bata na may bungang-araw.

19. Hindi ko matiis ang mga taong laging mangiyak-ngiyak.

20. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

21. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

22. Maraming tao sa tabing-dagat sa tag-araw.

23. Anung email address mo?

24. Isang araw, sa kanyang pagluluto hindi niya makita ang posporo.

25. Inilabas ng pulisya ang larawan ng salarin upang matulungan ang mga sibilyan na makakilala sa kanya.

26. Nandito ako sa mall. Trip lang, ayoko pang umuwi eh.

27. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

28. Online tutoring or coaching: If you have expertise in a particular subject, you can offer online tutoring or coaching services

29. Bago niya napanalunan ang ginto, si Hidilyn Diaz ay nagwagi na ng pilak na medalya sa Rio Olympics 2016.

30. They plant vegetables in the garden.

31. Marahil ay mas mahal ang presyo ng gulay ngayon kumpara sa nakaraang buwan.

32. Mga nuno, patawarin po ninyo ang aking anak.

33. At ignorere sin samvittighed kan føre til skyldfølelse og fortrydelse.

34. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

35. Madalas na nagiging dahilan ng utang ang kawalan ng sapat na pera upang matugunan ang mga pangangailangan.

36. Salatin mo ang kahon kung may natira pang laman.

37. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

38. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

39. Limitations can be frustrating and may cause feelings of disappointment and failure.

40. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

41. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

42. Nag toothbrush na ako kanina.

43. Ngunit tulad din ng mga ibon, tinanong nila kung bakit siya nasa kanilang kampo samantalang isa siya sa mga kaaway.

44. Ang kuripot ng kanyang nanay.

45. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

46. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

47. Madalas na mayroong mga organisasyon na nagsusulong ng kapayapaan at pagtigil ng digmaan.

48. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

49. Sinimulan ko ng basahin sa entry kung saan nakabuklat.

50. Marami sa atin ang may mga pangarap sa buhay na nais nating tuparin.

Recent Searches

resourcespandidiritrackcreatemagdadapit-haponnamulaklaktaonipinaalamneareservednagtatanimteachingskamayhinawakannakatirabahaymidtermrisestarstsaaeksamenbuwaninomkasibinataaayusinngunitkaysagabi-gabipositibogusalilalapitpagdiriwangconditionperahavesaangmahabahigitnunglazadamakuhangtrenkaniyanatatanawfridaynaglipanangmangyarisalitaanimartistaperokara-karakaeditarguesumpainnagbasanagkasunogstatesolarparticularflaviolugartrinafeelkaaya-ayangnawalanmamarilmalimutankandidatobeginningusaupuanparanguncheckedumagangtumalabtotoongtonettetindahankapamilyanagwelgapasyatiboksunud-sunodreorganizingrenombreremoterealreadingquelaryngitismakakasahodpulapopulationpoonpinagwagihangpagkikitapinagpinabayaanmagpagalingpilipinoniyonngumitinapanalulungkotnakapasoknakakaanimnakaakyatnagsisigawnaglulusakkutsaritangvehiclesnagbabasamukamendiolagayundinhitsurakumidlatkulangkongkatabingwouldnararapatkamakailankahonisangikawinuulaminalalayanikinuwentoikinabubuhayhumiwaganitohotelhabilidadesgumisingfonosfeareyaeuropeespadadefinitivokagandahanorderindali-dalicover,convertidasgawinconectancommissionsisentapiyanonakitulogomgcardbuwisbungabugbuginbotebilanggoautomatisereanak-pawisrebolusyonamingnageenglishadvancesplanning,onebirdsphysicalkakaroonskillswondershandaankwebatilamagkasabaymagpakaramileadersnag-away-awaypatongotrasbobonamanpalabritishnabiawangtapusinnasgawainbulsanagpapaniwalaparaangmaglaronaglalatangkumikinignagtatakboalas-diyesginoo