Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "evolucionado"

1. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

2. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

Random Sentences

1. Eh ano ba talaga problema sa bagong maid mo?

2. The website's contact page has a form that users can fill out to get in touch with the team.

3. Mahirap magpapayat kapag mahilig ka sa pulotgata dahil ito ay sobrang tamis.

4. Ang kahirapan ay isang laganap na suliranin sa ating bansa.

5. I have been jogging every day for a week.

6. Madalas siyang sumusulat kapag nag-iisa.

7. Practice makes perfect.

8. Inihanda ang powerpoint presentation

9. Kapag nalulong ka na sa droga, mahirap nang makalaya sa hawla nito.

10. Mas romantic ang atmosphere sa dapit-hapon.

11. Der er forskellige organisationer og grupper, der tilbyder støtte og ressourcer til transkønnede personer og deres familier.

12. Siya ay hindi marunong magtimpi kaya't laging nagmamalabis sa pagpapahayag ng kanyang saloobin.

13. Hindi naman sa ganun. Kaya lang kasi...

14. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

15. Los héroes son ejemplos de liderazgo y generosidad.

16. Sí, claro, puedo prestarte algo de dinero si lo necesitas.

17. "Ang hindi magmahal sa sariling wika, daig pa ang malansang isda" ay isang bukambibig na nagpapahayag ng pagpapahalaga sa ating sariling wika at kultura.

18. Sa aming klase, tinalakay namin ang iba't ibang anyo ng panitikan ng Pilipinas, at ito ay nagbibigay daan sa mas malalim na pag-unawa sa buhay.

19. Namatay ang mga pananim at ang tanging natira ay ang mga lasong puno na hitik na hitik sa bunga.

20. Eine hohe Inflation kann die Kaufkraft des Geldes drastisch reduzieren.

21. Have they visited Paris before?

22. En invierno, los árboles pierden sus hojas y se vuelven caducos.

23. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

24. It has been found that by abstaining from smoking a person may be cured of many diseases

25. Oscilloscopes are calibrated to ensure accurate measurement and traceability to national standards.

26. Stop beating around the bush and tell me what's really going on.

27. Kinakailangan niyang kumilos, umisip ng paraan.

28. Eating healthy is an important way to take care of your body and improve your quality of life.

29. La tecnología ha permitido la creación de nueva música y la producción de grabaciones de alta calidad.

30. Gabi na po pala.

31. Foreclosed properties can be a good investment opportunity for those who have the time and resources to manage a rental property.

32. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

33. Happy birthday sa iyo!

34. I have never eaten sushi.

35. Hindi dapat natin ipagkait ang mga oportunidad na dumadating sa atin, datapapwat ay hindi ito madaling makamit.

36. Napakagaling nyang mag drawing.

37. Ang Mabini Colleges sa Daet, Camarines Norte ay isa sa mga pinakamalalaking paaralan sa lugar.

38. Sa aming tahanan sa tabing-karagatan, mahinahon ang aming buhay.

39. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

40. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

41. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

42. Different investment vehicles offer different levels of liquidity, which refers to how easily an investment can be bought or sold.

43. Kahit nasa gitna ng kainan, siya ay tulala at parang may iniisip.

44. Algunas personas se dedican a crear arte como su profesión.

45. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

46. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. The tree provides shade on a hot day.

49. Nakakasama sila sa pagsasaya.

50. Investing refers to the process of allocating resources with the expectation of generating a profit.

Similar Words

revolucionado

Recent Searches

evolucionadonagbuwiskalabawmaiingaymariaasoginawangthirdpalagisisikatbigongkundimangustongnutrienteshimutokernanislandmatabapulapongcesdistancesalitaptapbangyangtilpresidentepatawarinnanaigangkingreloperangebidensyafarmipagmalaakidisyemprepopularizemabangopagtitindakotsesumigawtomarnakahigangitlogmarahilpagkatmahalagacruzskirtpakakasalanlunespisaratuloy-tuloymalakingibinigaykinagagalakbentangkinabibilangannanamankumakainumiibigbahay-bahayannagwalishawakmananaloramdampinakainnagdaankerbpakialampulangmaritesnicolasanimobakehvorsang-ayonbaroclipnaantigt-isapinag-usapannasalumampasinalagaanpaglalabadadaangitinuturonababasaeroplanokatulongsakopreaksiyongivebayaningmanalomangungudngodmanykatagangmagbungaginoongmarasigannaputolpagkabuhayhumaboleditorumabogmabagalmakakatakasmamimilikahoynagawangumigibtigreipagbilihalamanmagalingaraw-arawpaalissasagotconsistmasinopsagasaanpalagaynananalongtelecomunicacionesnakinigperpektopaboritongnapakabutimakatarungangnasantinagalungkutipipilitkainitandosenangnabitawanuugod-ugodhinanakitnagpipilithongsariwahumahangoswesttabakakayurintumambadlimossagotindvirkningmagtipidspecialsusibagongmakuhayayakunehonohsyangincrediblesagingnagpasyacamerapitakanakasakitiskomabiliskasalukuyanpanghabambuhaypalapagrenaiapusakombinationyourpagpapasakitmaluwangnabagalanagostobaccooccidentalkutsilyoopportunitymaynakatanggapnatutokmaghugasnadadamaymataposrosariokababaihanbibigyanfarmagpahabamagdaraoscalambasarapkatutubopaglipaspagdiriwang