Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "evolucionado"

1. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

2. La música es una forma de arte que ha evolucionado a lo largo del tiempo.

Random Sentences

1. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

2. Acts of kindness, no matter how small, contribute to a more charitable world.

3. He's always telling tall tales, so take his stories with a grain of salt.

4. May I know your name for networking purposes?

5. Television has also had an impact on education

6. La creatividad es fundamental para el desarrollo de ideas innovadoras.

7. He admires the athleticism of professional athletes.

8. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

9. Masanay na lang po kayo sa kanya.

10. Nag-aaral siya sa library gabi-gabi.

11. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

12. Sa mapa, makikita mo ang mga pook na may magandang tanawin.

13. Huwag ring magpapigil sa pangamba

14. Da Vinci murió en Francia en el año 1519.

15. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

16. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

17. The lightweight construction of the bicycle made it ideal for racing.

18. Einstein was offered the presidency of Israel in 1952, but declined the offer.

19. AI algorithms are constantly evolving and improving, with new advancements being made in fields such as deep learning and reinforcement learning.

20. Tinapos ko ang isang season sa netflix kaya napuyat ako.

21. Namumuo ang pawis sa kanyang anit at sa ibabaw ng kanyang nguso.

22. Les mathématiques sont une discipline essentielle pour la science.

23. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

24. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

25. We have already paid the rent.

26. Ate Annika naman eh, gusto ko ng toy!

27. Después de la lluvia, el sol sale y el cielo se ve más claro.

28. The pneumonia vaccine is recommended for those over the age of 65.

29. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

30. I have a craving for a piece of cake with a cup of coffee.

31. Tumango lang ako. Wala ako sa mood na magsalita.

32. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

33. Mathematics has many practical applications, such as in finance, engineering, and computer science.

34. Nangagsipagkantahan kami sa karaoke bar.

35. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

36. La poesía de Whitman tiene una belleza sublime que transmite su amor por la naturaleza.

37. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

38. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

39. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

40. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

41. Aalis na ko mamaya papuntang korea.

42. No hay mal que por bien no venga.

43. The website has a lot of useful information for people interested in learning about history.

44. Ang kundiman ay patunay na ang musika ay isang malakas na kasangkapan sa pagpapahayag ng mga damdamin.

45. Nagreport sa klase ang mga grupo nang limahan.

46. Omelettes are a popular choice for those following a low-carb or high-protein diet.

47. Mi amigo me enseñó a tocar la guitarra y ahora podemos tocar juntos.

48. Ang mga salitang mapusok ng kundiman ay naglalarawan ng pagnanasa at pagsisigaw ng pusong umiibig.

49. All these years, I have been working hard to achieve my dreams.

50. Gusto ko na talaga mamasyal sa Japan.

Similar Words

revolucionado

Recent Searches

magkanoevolucionadonausalmatagaltatayoisinaramaibamatutongmisyunerongnatutulogkuligligumokayisinalaysaypinaulanancaracterizalikodnapawimagpakaramina-curiouspapayamagkabilangmagsabinagbibigayanlangkaypinabulaantamadkambingeksportennayonnewspapersproducts:wonderflamencoabutankayobibiliydelsercaraballomaranasanumabotmanalohanapinpanunuksonaglabarenatomatarayyunhikingnetflixmatapanganikriskanenatenerkahusayanmaistorbopinalayashagdansocialecareersacrificenapagodkenjimusiciansiconictingrhythmabizoomlatestibalikmisusedconectadosbatayproperlysumusunoredesbumahaumingitasulahit1980earnkamatisbestginhawanicomaskipriestdinanaskasoanywherelandfilmsbutchbuenaedsalumilingonnuhsikosusuliteclipxepataydiyosalaycarddecreasecompleteshouldbackusinggitarastringipinalutospread2001nariningsambitseparationbroadcastingbathalahapdifroginternajohnprusisyonnatagalanmarahangrawearlytextokararatingelectionbellbranchesbiroespadadontstevecadenabinigyangsusunduinsumugodrailflexibleperlaaalisjudicialasimultimatelypoloiniinombecomingfurmaestrobatokwordallowinghousemakisigprinceisaacoperahankalakingipapaputolfionaisinisigawsino-sinokailanmorenanapatawagfanssystematiskhaloskumustaitsurakittulisanniyogsumarapsasamahanbiyaskayparangsinongetopagigingerlindapang-araw-arawtomorrowkawalanaminnapaangatkanya-kanyangtenderpaaemocionantemanilbihankontrapumili