Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "break"

1. Before a performance, actors often say "break a leg" to each other for good luck.

2. Break a leg

3. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

4. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

5. He does not break traffic rules.

6. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

9. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

10. I usually like to tell a joke to break the ice at the beginning of a presentation.

11. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

12. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

13. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

14. I've got a big presentation at work today - I hope I don't break a leg!

15. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

16. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

17. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

18. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

19. My daughter is in her school play tonight - I told her to break a leg.

20. My grandfather used to tell me to "break a leg" before every soccer game I played.

21. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

22. The director shouted "break a leg!" as we went onstage.

23. The momentum of the ball was enough to break the window.

24. To break the ice at a party, I like to start a game or activity that everyone can participate in.

25. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

26. Tuwing Marso hanggang Hunyo ang summer break

27. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

28. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

29. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

Random Sentences

1. Naglabas ako ng malalim na himutok matapos kong matalo sa paligsahan.

2. Walang makakibo sa mga agwador.

3.

4. Pinagpalaluan si Maria ng kanyang mga kapatid dahil sa kanyang sipag at tiyaga.

5. Gaano ka kadalas pumunta sa doktor?

6. La música clásica es una forma de música que ha existido durante siglos.

7. He has been writing a novel for six months.

8. Bago pa man maghatinggabi ay dumating nga ang prinsipe at lubos na nalugod ang nag-aalalang prinsesa.

9. Sorry, I didn't catch your name. May I know it again?

10. Ang mga halaman sa bukid ay natutuyo dahil sa matinding tagtuyot.

11. Hindi ko alam kung paano ko malalampasan ang aking mga agam-agam tungkol sa aking trabaho.

12. He used his credit to buy a new car but now struggles to make the monthly payments.

13. Gaano katagal ako maghihintay sa bus?

14. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

15. Oh sige na nga sabi mo eh. hehe.

16. Mayroong nakawan sa bahay namin kahapon, pero aksidente namin naabutan ang mga magnanakaw.

17. Sa kabila ng mga pagsubok, hindi siya sumusuko at pinagsisikapan na mapabuti ang kanyang buhay.

18. Dedication is what separates those who dream from those who turn their dreams into reality.

19. Las heridas punzantes, como las causadas por clavos o agujas, pueden ser peligrosas debido al riesgo de infección.

20. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

21. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

22. Nasa gitna ng kanyang pagsasalita, napadungaw siya sa kanan at nakita ang isang bata na tumatawa.

23. Sa likod ng mga tala, kahit sulyap lang, Darna

24. Nagpasya ang salarin na sumuko sa pulisya matapos ang mahabang panlilinlang.

25. Hindi ako maaring abutan ng hatinggabi, kapag hindi ako umalis ngayon ay hindi na ako makakabalik pa sa amin.

26. Ahhh...wala! Bakit ba, nagdadasal ako noh!

27. Ang ganda ng swimming pool!

28. The political campaign gained momentum after a successful rally.

29. Ang sabi nya inaantay nya daw girlfriend nya! Ang sweet!

30. Claro, haré todo lo posible por resolver el problema.

31. Kailangan mong lumabas sa iyong kahon upang makita mo ang kaibuturan ng mundo.

32. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

33. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

34. Les impôts sont une source importante de revenus pour l'État.

35. Les algorithmes d'intelligence artificielle peuvent être utilisés pour optimiser la consommation d'énergie dans les bâtiments.

36. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

37. Amazon's Kindle e-reader is a popular device for reading e-books.

38. Musk has expressed interest in developing a brain-machine interface to help treat neurological conditions.

39. The momentum of the ball was enough to break the window.

40. Masakit ba?? Tumingin siya sa akin, Masakit na naman ba??!!

41. There are a lot of benefits to exercising regularly.

42. Mababaw ang swimming pool sa hotel.

43. Sus gritos están llamando la atención de todos.

44. Foreclosed properties are homes that have been repossessed by the bank or lender due to the homeowner's inability to pay their mortgage.

45. Sa mundong ito, hindi mo alam kung kailan ka magiging biktima ng agaw-buhay na krimen.

46. Ngunit hindi napigilan si Magda ng kanyang mga anak.

47. Aling hiwa ng baboy ang gusto mo?

48. El nacimiento es el comienzo de una vida llena de aprendizaje, crecimiento y amor.

49. Eating healthy is essential for maintaining good health.

50. La tos puede ser un síntoma de afecciones menos comunes, como la sarcoidosis y la fibrosis pulmonar.

Similar Words

Heartbreak

Recent Searches

pagamutanarbularyobreakmakapagbigaynagbuntongbuhaydi-kawasatabing-dagatnatutulognapakahabaubobasketsanggolatinwalngresearch:juankategori,geologi,nagmamaktolkasalukuyanpagdukwangnakasahodnamumulotmakapagsabirevolutioneretsaritainilalabasmamanhikaneconomynagtuturomakakawawahumalakhakhinipan-hipanbaranggaypanghabambuhaynakakatabatanggalinnaapektuhanmanatilihoneymoonkinalilibinganmakatatlonagbantaynakabibingingpinangalananglumutangaga-agasasakayhouseholdabut-abothumalolumilipadpatawarintiyakiniresetataga-ochandopabulongnatatawanaglutocanteengiyerakutsaritangmaibigaygurotuyopagmasdankilaypaaralannawalapornilaoshumihingisarisaringlakingawardmataaasnapakohumigamalilimutanallenovembergusting-gustonapakabiglaanisinalaysaydyosaniyannatatanawhinagissabongmakausapkababalaghangsapatpakisabibalatandresbestidabisikletasumimangotkunwainventadokumakantalingidilocosnahihilodumaanisamaadvancecarmendisseginaganoonmeronbibilhinjoekabosesgabinglagimagtipidibinalitangpakilutoadoptedindustrytillcreditsipagnegativeniyaaksiyonahitplacecivilizationeventsabalalutosenatebranchrosaclientsritwal,specializedmulicomplicatedguardaredesbuwalproveumiilingfacebookcardipagbilinapabalikwasmind:darkidea:visdancenalasingluisaddressabstainingpangulotarangkahanmatabayeahsolidifysyncgraduallycablebowbabearmeddosfigureinilistawifijosefapilitbesidesnamulaklakmakasahodintindihinmagkakagustoumaboginuulcermatulunginbilihinopportunitieskagubatansentencesolarrestawankinatatayuanmakamitsabihinna-fundkulunganpamasahebrancher,nagloko