Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

29 sentences found for "break"

1. Before a performance, actors often say "break a leg" to each other for good luck.

2. Break a leg

3. Football games are typically divided into two halves of 45 minutes each, with a short break between each half.

4. Forgiveness is a gift we give ourselves, as it allows us to break free from the chains of resentment and anger.

5. He does not break traffic rules.

6. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. I always make sure to ask a lot of questions to break the ice and get to know my new coworkers.

9. I have an important interview today, so wish me luck - or, as they say in the theater, "break a leg."

10. I usually like to tell a joke to break the ice at the beginning of a presentation.

11. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

12. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

13. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

14. I've got a big presentation at work today - I hope I don't break a leg!

15. In theater, "break a leg" is a way of wishing someone good luck without actually saying it.

16. It can be awkward to meet someone for the first time, so I try to find common ground to break the ice.

17. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

18. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

19. My daughter is in her school play tonight - I told her to break a leg.

20. My grandfather used to tell me to "break a leg" before every soccer game I played.

21. Sometimes all it takes is a smile or a friendly greeting to break the ice with someone.

22. The director shouted "break a leg!" as we went onstage.

23. The momentum of the ball was enough to break the window.

24. To break the ice at a party, I like to start a game or activity that everyone can participate in.

25. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

26. Tuwing Marso hanggang Hunyo ang summer break

27. When I'm feeling nervous about networking, I remind myself that everyone is there to break the ice and make connections.

28. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

29. When we forgive, we break the cycle of resentment and anger, creating space for love, compassion, and personal growth.

Random Sentences

1. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

2. Ang galing nya maglaro ng mobile legends.

3. Umutang siya dahil wala siyang pera.

4. The disagreement between them turned out to be a storm in a teacup.

5. Limitations can be viewed as opportunities for growth and personal development.

6. Ilan ang computer sa bahay mo?

7. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

8. Honesty is the best policy.

9. Tanging si Tarcila lang ang walang imik ngunit malalim ang iniisip.

10. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

11. Mi amigo del colegio se convirtió en un abogado exitoso.

12. Alam ko na mayroong magandang intensyon ang kanilang plano, ngunit hindi ako sang-ayon dito kaya ako ay tumututol.

13. Nakatira ako sa San Juan Village.

14. Trump's foreign policy approach included renegotiating international agreements, such as the North American Free Trade Agreement (NAFTA) and the Paris Agreement on climate change.

15. Magkita na lang po tayo bukas.

16. Kailan nangyari ang aksidente?

17. Bumili si Andoy ng sampaguita.

18. "Ang hindi lumingon sa pinanggalingan, hindi makakarating sa paroroonan" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pag-alala at pagpahalaga sa mga pinagmulan.

19. Umupo sa harapan ng klase ang mga mag-aaral nang limahan.

20. Some fruits, such as strawberries and pineapples, are naturally sweet.

21. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

22. Nabangga ang kotse ni Juan bandang alas-tress ng hapon.

23. Hoy en día, el internet es una parte integral de la vida cotidiana.

24. Minsan, masarap din namang kumain ng nag-iisa para mapag-isipan ang mga bagay-bagay.

25. Nakalimutan kong magdala ng flashlight kaya nahirapan akong makita sa pagdidilim ng gubat.

26. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

27. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

28. In this industry, singers who can't write their own songs are a dime a dozen.

29. The lightweight construction of the bicycle made it ideal for racing.

30. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

31. Tobacco was first discovered in America

32. Hindi malinis ang tubig na iyan, bumili ka ng iba.

33. "Love me, love my dog."

34. In Spanish cuisine, a tortilla española is a thick omelette made with potatoes and onions.

35. La tos seca es una tos que no produce esputo o flema.

36. Gracias por creer en mí incluso cuando dudaba de mí mismo/a.

37. Drømme kan inspirere os til at være vores bedste selv og opnå vores fulde potentiale.

38. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

39. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

40. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

41. Nasa ilalim ng mesa ang payong.

42. Nous allons nous marier à l'église.

43. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

44. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

45. How I wonder what you are.

46. Dadalawin ko ang aking mga alagang palaka sagot ng dalaga

47. Papunta siya sa Davao bukas ng tanghali.

48. Nakarating na si Ana sa gubat at pumasok sa isang kweba at lumabas ng may dalang basket na puno ng ibat-ibang uri ng gulay.

49. A penny saved is a penny earned.

50. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

Similar Words

Heartbreak

Recent Searches

breakideaforskelmahabolkatawanchangeddispositivomalayongataquesnahulinagbuwisnakakamanghatatlongnagsipagtagomanlalakbaykasalukuyanibignagtitindajuliusbabakanakawalaniiwasansementeryoiba-ibangsapagkatclosetoymakabawih-hoypamamasyalshehalagareynahalamananpinagfinishednakabasagpasiyenteminamahalbingbinghila-agawanmalusogmangindustriyakahalagaindiapatientsalatsinapitawitpag-iinatmalimitexitmonsignorkontingahhhhitinuturosuccessfullegislationlandodangerouspabalangbateryakahilingandefinitivopagkabatainalismabangodibdibmarianagbakasyonnapakagandangkontinentenglabinsiyamlalabhanistasyonnakakatabanagtakamakakibokirotmatigastalagalihimtawanannovemberalagahininginaglulutoinaabotpatawarine-booksnakainommangyaritaga-ochandonuclearpabulongbroadmagkapatidnagmadalingnakasandigpinabayaanpamahalaansasayawinalikabukinlabisnauliniganinjurypinamalagibusinessespangyayarinanlakipaki-drawingtenidocreditmaglabapayapangdumilatincredibleawitanpantaloncurrentmagagandangmeetanimoaywanroomgamotomgfuelmatatandafansfiguresmagingage1973malapitjameshappyinteractfallsomeconditioningechavesusulitenforcingloobeskwelahankahonibat-ibangmahiwagangnagnakawnagbagodetectedhinalungkatpagtataposnangangaralpaaralanbalitahulunamumutlabalikatkaklaseadvanceddulotfilmsadicionaleslasingeroproblemakarganagsisikainnakabaonitinaascupidsundalofascinatingabshumaloamoysubalitkumakainipinatawchristmasopotungkolnagsisunodpinag-aaralanpangangatawanyumabongsaanmakalabasalasmbalololojuanitoinasikasopalaylalongpangakorosas