Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

46 sentences found for "often"

1. A successful father-child relationship often requires communication, patience, and understanding.

2. A successful marriage often requires open communication and mutual respect between a husband and wife.

3. And often through my curtains peep

4. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

5. Baby fever is a term often used to describe the intense longing or desire to have a baby.

6. Before a performance, actors often say "break a leg" to each other for good luck.

7. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Dogs are often referred to as "man's best friend".

10. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

11. Einstein was an accomplished violinist and often played music with friends and colleagues.

12. Emphasis is often used in advertising and marketing to draw attention to products or services.

13. Emphasis is often used to highlight important information or ideas.

14. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

15. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

16. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

17. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

18. High blood pressure can often be managed with a combination of medication and lifestyle changes.

19. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

20. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

21. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

22. Nationalism is often associated with symbols such as flags, anthems, and monuments.

23. Nationalism often emphasizes the importance of a common language, culture, and history.

24. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

25. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

26. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

27. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

28. Starting a business during an economic downturn is often seen as risky.

29. Sweet foods are often associated with desserts, such as cakes and pastries.

30. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

31. The king's family and heirs are often closely watched by the public and the media.

32. The king's role is often ceremonial, but he may also have significant political power in some countries.

33. The king's royal palace is his residence and often serves as the seat of government.

34. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

35. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

36. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

37. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

38. The title of king is often inherited through a royal family line.

39. The wedding ceremony is often followed by a honeymoon.

40. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

41. They are often served with a side of toast, hash browns, or fresh greens.

42. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

43. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

44. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

45. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

46. Women have often been the primary caregivers for children and elderly family members.

Random Sentences

1. Les programmes sociaux peuvent aider à réduire la pauvreté et l'inégalité.

2. His films, teachings, and philosophy continue to inspire and guide martial artists of all styles

3. Mens gambling kan være sjovt og spændende, er det også vigtigt at huske på, at det kan have negative konsekvenser, hvis det ikke håndteres på en ansvarlig måde.

4. Når man bliver kvinde, åbner der sig mange nye muligheder og udfordringer.

5. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

6. A successful marriage often requires open communication and mutual respect between a husband and wife.

7. Børn har brug for tryghed, kærlighed og omsorg for at udvikle sig optimalt.

8. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

9. Natayo ang bahay noong 1980.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Maarte siya sa mga lugar na pupuntahan kaya hindi siya nakikipagsiksikan sa mga madaming tao.

12. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

13. Umaasa si Carlos Yulo na mas maraming kabataan ang mahihikayat na pasukin ang larangan ng gymnastics.

14. Ang pagkakaroon ng magandang asal at ugali ay mahalaga sa bawat relasyon, samakatuwid.

15. Videnskaben er opdelt i flere forskellige discipliner, såsom fysik, kemi, biologi og geologi, og hver disciplin har sin egen metode og fokusområde

16. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

17. Nagwalis ang kababaihan.

18. Andyan kana naman.

19. Hindi naman. Baka lang pagod ka na...

20. Mabait siya at nanggagamot siya nang libre.

21. Maarte siya sa mga kainan kaya hindi siya mahilig sa mga fast food chain.

22. Bagaimana pendapatmu tentang film yang baru saja tayang? (What is your opinion on the latest movie?)

23. He collects stamps as a hobby.

24. Third parties, such as the Libertarian Party and the Green Party, also exist but have limited influence

25. Les médecins et les infirmières sont les professionnels de santé qui s'occupent des patients à l'hôpital.

26. Where there's smoke, there's fire.

27. Naulinigan ng makapangyarihang Ada himutok ng Buto.

28. Ang pagbibigay ng oras at pag-aalaga sa mga alagang hayop ay nakagagamot sa aking kalooban at nagbibigay ng pagmamahal.

29. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

30. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

31. Mabilis ang takbo ng pelikula.

32. Inflation kann auch durch externe Faktoren wie Naturkatastrophen verursacht werden.

33. Nabahala si Aling Rosa.

34. Up above the world so high

35. Les personnes âgées peuvent être sujettes à des chutes et d'autres accidents.

36. Ibinigay ng aking guro ang kanyang oras at dedikasyon upang masiguro ang aming matagumpay na pagkatuto.

37. Sa buong buwan ng Disyembre, ang mga mall ay hitik sa mga pamaskong dekorasyon at mga regalo.

38. Naibaba niya ang nakataas na kamay.

39. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng positibong pananaw at pagpapakita ng determinasyon.

40. Guten Abend! - Good evening!

41. Cosecha el maíz cuando las espigas estén completamente maduras

42. He has been building a treehouse for his kids.

43. May gamot ka ba para sa nagtatae?

44. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

45. Nice meeting you po. automatic na sabi ko.

46. Kailangan nating magbago ng mga lumang gawi, datapapwat ay mahirap ito gawin dahil sa kawalan ng disiplina ng iba.

47. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

48. Cancer can impact not only the individual but also their families and caregivers.

49. The bakery specializes in creating custom-designed cakes for special occasions.

50. Hiramin ko muna ang iyong libro para magkaruon ako ng kopya nito.

Recent Searches

oftenformatamazonstyrermanagerpilingconsidertaon-taonmarilouwidespreadcontinuedmananalonapatulalanasanahahalinhaneksport,varietytrajesukatdiagnosesnangyayaricassandranaglalabaninongcompositoreshundrednanlilisikmatalinotopiclargeledpromotenagwelganakumbinsianak-pawisinvesting:napapansintumatawadmagturopisaranalugodtrentabiglasisidlanpinalayasyamansueloanibinabaliksingeralinthroughoutsamahanlangkayhumpaydollarallowingdiedmakawalasiksikanpagkaangatmapaikotproudedsanayonmangkukulampamanhikannagpapakainnalalamannangampanyamaglalakadnakaupoikinamataynakakitanamumulaklaknagkapilatkinauupuannagpabayadnagkwentonakakagalaumiiyakpagsalakaysasayawinwastesulyaptumatanglawnaabutannagtalagasasamahanpagkagustotagtuyotuusapanmagpapigilmakabawikontratapagkaraamensahenakakainpahirampresidenteuniversitymaghihintayunidosmarketing:pamagatkolehiyotahimiknakisakaymatagumpaykarapatangkapatagannglalabamatumalrodonabinge-watchingpagsusulitfreedomsuniversitiesmaluwaghinatidpananakitmusicniyogkaharianpagmagsimulamatangumpaypinilitperseverance,maramotlalimminahanginaanghelsadyangkendibuwayasayapaggawakaniyarobinhoodibigaykasakitpresleymalapitanganidkasamaexpresansaleskutodhumayotapewalongstruggledbasahinmalumbayelectoralsineroselleremain1787lagimassesmeaningitinagomakasarilinglettertherapysumarapleukemiaconvertidasmisabecomeleocupidbiyerneskinagalitanataoperatepedejamescoaching:magbungareservedmuchasgawingawingkagandahagolivabingisomeevilbehalfbabeeducationalplantargetkingincludesolidify