Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

46 sentences found for "often"

1. A successful father-child relationship often requires communication, patience, and understanding.

2. A successful marriage often requires open communication and mutual respect between a husband and wife.

3. And often through my curtains peep

4. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

5. Baby fever is a term often used to describe the intense longing or desire to have a baby.

6. Before a performance, actors often say "break a leg" to each other for good luck.

7. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Dogs are often referred to as "man's best friend".

10. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

11. Einstein was an accomplished violinist and often played music with friends and colleagues.

12. Emphasis is often used in advertising and marketing to draw attention to products or services.

13. Emphasis is often used to highlight important information or ideas.

14. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

15. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

16. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

17. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

18. High blood pressure can often be managed with a combination of medication and lifestyle changes.

19. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

20. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

21. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

22. Nationalism is often associated with symbols such as flags, anthems, and monuments.

23. Nationalism often emphasizes the importance of a common language, culture, and history.

24. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

25. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

26. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

27. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

28. Starting a business during an economic downturn is often seen as risky.

29. Sweet foods are often associated with desserts, such as cakes and pastries.

30. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

31. The king's family and heirs are often closely watched by the public and the media.

32. The king's role is often ceremonial, but he may also have significant political power in some countries.

33. The king's royal palace is his residence and often serves as the seat of government.

34. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

35. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

36. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

37. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

38. The title of king is often inherited through a royal family line.

39. The wedding ceremony is often followed by a honeymoon.

40. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

41. They are often served with a side of toast, hash browns, or fresh greens.

42. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

43. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

44. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

45. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

46. Women have often been the primary caregivers for children and elderly family members.

Random Sentences

1. He admires the honesty and integrity of his colleagues.

2. The acquired assets included several patents and trademarks.

3. Gusto rin nilang patunayan kung siya nga ay magaling tulad ng napabalita.

4. Paano niya malilimutan si Ogor? Sa mula't mula pa, itinuring na siya nitong kaaway, di kailanman binigyan ng pagkakataong maging kaibigan.

5. The sun is not shining today.

6. The police were trying to determine the culprit behind the burglary.

7. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

8. Sa ganang iyo, ano ang pinakamagandang gawin upang mapaunlad ang ating bayan?

9. Padabog akong umupo habang dumadating na yung order nya.

10. Ang sarap maligo sa dagat!

11. Uanset ens religiøse overbevisning er påsken en tid til at fejre håbet om nyt liv og genfødsel.

12. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

13. Lazada has expanded its business into the logistics and payments sectors, with Lazada Express and Lazada Wallet.

14. Sang-ayon ako sa kagustuhan mo na magpatuloy sa iyong pag-aaral.

15. Palagi niyang suot ang kanyang korona upang ipakita na siya ay makapangyarihan.

16. Pakilagay mo nga ang bulaklak sa mesa.

17. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Ang daming labahin ni Maria.

20. Sinimulan ko ng basahin sa entry kung saan nakabuklat.

21. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

22. All these years, I have been blessed with the love and support of my family and friends.

23. Pumuslit ang luha sa sulok ng kanyang mga mata.

24. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

25. The project is taking longer than expected, but let's hang in there and finish it.

26. May mga taong may kondisyon tulad ng insomnia na nagdudulot sa kanila ng problema sa pagtulog.

27. Hindi malaman kung saan nagsuot.

28. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

29. Pigilan nyo ako. Sasapakin ko talaga 'tong isang 'to.

30. Hinugot niya ang lakas ng kanyang katawan upang maitulak ang sasakyan na nabangga.

31. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

32. Sa gitna ng kaniyang pag-aaral, napadungaw siya sa katabing silid at nakita ang kanyang kaibigan.

33. Nakasuot siya ng itim na pantalon.

34. The culprit behind the data breach was able to exploit a weakness in the company's security.

35. Ang pagdidilim ng aking paningin ay nagpahiwatig ng pagdating ng masamang panahon.

36. Napuyat ako kakapanood ng netflix.

37. Ang ganda naman ng bago mong phone.

38. Nagmumukha siyang Intsik-beho kapag suot iyon ngunit wala naman siyang maraming kamisetang maisusuot.

39. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

40. Malamig sa Estados Unidos kung taglagas.

41. Umiinom si Andy ng vitamins kaya ang katawan nito ay bihirang magkasakit.

42. Kaninang bandang alas-diyes ng umaga.

43. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

44. "Mahalaga ang edukasyon," ani ng aking ama noong bata pa ako.

45. Sa kabila ng pag-usbong ng modernong medisina, nananatili pa rin ang tiwala ng marami sa albularyo.

46. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

47. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

48. Sayang, jangan lupa untuk makan malam nanti. (Dear, don't forget to have dinner tonight.)

49. Napakamisteryoso ng kalawakan.

50. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

Recent Searches

styrerallowedoftenturnstringmagkahawakkabarkadalalawigannalakitwofeedback,maasahankuligligkawili-wilirenombreiba-ibanghangaringmalapadbingiwantskills,pinaghalodasalpinagalitannakatuwaangbolapagpapautangmagbabagsikbinigaynararapatmagasawangbinanggadragonwasakcalciumpackagingcaraballosharmainepagkalitonapakamisteryosokamatisyouthlumayoinangkuwento1929labasmaskarahouseholdnaawatiemposmusicianmayamanggumuhitnag-googlepangalananidiomacashthroughdraft,meronpnilitbinatilyoproductionbasahanwordspootbugtongpakanta-kantangambagpopulation4thmaya-mayalilikoumiibigwashingtonpinilittignanmedyomatabangsamakatwidfameskypeinalalayanpasokellaperangmabaittanawginasong-writingryanmultopapuntangpasyalanpinunitnilutoheiomgviewkumustarelativelywebsiteipapahingaevenkalalakihantabing-dagatexplainechaveprocessmagtatagalgobernadorkinamumuhianpagka-maktolnakauponagtitiiskasalukuyannagngangalangnagliliwanagvaliosapatutunguhanpresidentialnangangahoyikinasasabiknagkakakainsalamangkeronamumuonghinagud-hagodkagandahagpinakamagalingnakakatawamakikiligoyoutube,magkaharapexhaustionbagsaknanlalamigpagtutolsinasadyanapasigawnagmadalingmangkukulamloribigkaklasenatulogt-shirtmagpaliwanageskuwelabahalarongmeriendakaloobangi-googlemakikiraanmumuramang-aawitnakakapasokobserverermulananglingidpaanongnagmistulangbalitakapamilyaflyvemaskinerpahahanappagkabuhaymensajesnagliwanagmakikipaglaronananalonagnakawformatplatformhoneymoonmedicalmontrealuugod-ugodtinakasanmaisusuotkumalmanakabawinahintakutanpaki-chargepaghaharutansagasaanayanapakamotpunongnababalotkolehiyointindihintaglagashahatolmaintindihansalbahengthanksgivingnaghihirap