Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

46 sentences found for "often"

1. A successful father-child relationship often requires communication, patience, and understanding.

2. A successful marriage often requires open communication and mutual respect between a husband and wife.

3. And often through my curtains peep

4. Athletes who achieve remarkable feats often credit their success to their unwavering dedication and training regimen.

5. Baby fever is a term often used to describe the intense longing or desire to have a baby.

6. Before a performance, actors often say "break a leg" to each other for good luck.

7. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

8. Cryptocurrency is often subject to hacking and cyber attacks.

9. Dogs are often referred to as "man's best friend".

10. Dogs have a keen sense of smell and are often used in law enforcement and search and rescue operations.

11. Einstein was an accomplished violinist and often played music with friends and colleagues.

12. Emphasis is often used in advertising and marketing to draw attention to products or services.

13. Emphasis is often used to highlight important information or ideas.

14. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

15. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

16. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

17. Grande is renowned for her four-octave vocal range, often compared to Mariah Carey.

18. High blood pressure can often be managed with a combination of medication and lifestyle changes.

19. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

20. I don't eat fast food often, but once in a blue moon, I'll treat myself to a burger and fries.

21. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

22. Nationalism is often associated with symbols such as flags, anthems, and monuments.

23. Nationalism often emphasizes the importance of a common language, culture, and history.

24. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

25. Political campaigns use television to reach a wide audience, and political debates and speeches are often televised

26. Representatives often collaborate with other officials and stakeholders to achieve common goals and address broader societal issues.

27. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

28. Starting a business during an economic downturn is often seen as risky.

29. Sweet foods are often associated with desserts, such as cakes and pastries.

30. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

31. The king's family and heirs are often closely watched by the public and the media.

32. The king's role is often ceremonial, but he may also have significant political power in some countries.

33. The king's royal palace is his residence and often serves as the seat of government.

34. The Lakers have a large and passionate fan base, often referred to as the "Laker Nation," who show unwavering support for the team.

35. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

36. The symptoms of high blood pressure are often silent and can be dangerous if left untreated.

37. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

38. The title of king is often inherited through a royal family line.

39. The wedding ceremony is often followed by a honeymoon.

40. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

41. They are often served with a side of toast, hash browns, or fresh greens.

42. Trump's presidential campaigns in 2016 and 2020 mobilized a large base of supporters, often referred to as "Trumpism."

43. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

44. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

45. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

46. Women have often been the primary caregivers for children and elderly family members.

Random Sentences

1. The computer programmer wrote a series of codes, debugging and refining each one until the project was complete.

2. If you think he'll lend you money, you're barking up the wrong tree.

3. Si Aling Juana ang tagalaba ng pamilya.

4. Ngumiti lang ako sa kanya at nagsimula muling halikan siya.

5. Napahinga ako ng malakas kaya napatingin siya sa akin

6. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

7. Wala kang pakelam! O sige its my turn na!

8. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

9. May mga salarin na gumagamit ng iba't ibang modus operandi upang mabiktima ang mga tao.

10. Kaya't tama lamang na ito rin ay kanyang ipapamana sa nag-iisang anak.

11. Umalis sa sakayan ang mga pasahero nang limahan.

12. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

13. Dumating na ang araw ng pasukan.

14. Bilang paglilinaw, hindi ako ang nagsimula ng usapan, ako lang ang sumagot sa tanong.

15. Dahil sa mabuti niyang pagtuturo, naging interesado ako sa agham at naging guro rin ako.

16. Dadalaw ako kay Lola Sela bukas.

17. I've been following the diet plan for a week, and so far so good.

18. Una de mis pasatiempos más antiguos es coleccionar monedas y billetes de diferentes países.

19. Yehey! si Mica sabay higa sa tabi ko.

20. Biglang naalaala ni Aling Rosa ang huli niyang sinabi kay Pina, na sana'y magkaroon ito ng maraming mata para makita ang kanyang hinahanap.

21. They have already finished their dinner.

22. Saan siya kumakain ng tanghalian?

23. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

24. He bought a series of books by his favorite author, eagerly reading each one.

25. Lebih baik mencegah daripada mengobati.

26. Mahilig siyang mag-ehersisyo at kumain ng masustansya, samakatuwid, malakas ang kanyang pangangatawan.

27. Nanghihinamad at naghihikab na iniunat ang mahahabang kamay.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Nagdala ako ng mga bagong libro sa silid-aralan upang makapagbahagi sa mga kaklase.

30. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

31. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

32. Higupin mo muna ang sabaw bago kainin ang noodles.

33. The number you have dialled is either unattended or...

34. Marami silang pananim.

35. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

36. Sa pagsalubong ng Bagong Taon, ang langit ay hitik sa mga kulay sa pamamagitan ng mga paputok at mga fireworks display.

37. El lienzo es la superficie más común utilizada para la pintura.

38. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

39. Nakapila sila sa kantina nang limahan para maging maayos.

40. The wedding rehearsal is a practice run for the wedding ceremony and reception.

41. Nandito ako sa entrance ng hotel.

42. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

43. La realidad es que necesitamos trabajar juntos para resolver el problema.

44. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

45. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

46. Maari bang pagbigyan.

47. Emphasis can help to ensure that a message is received and understood by the intended audience.

48. Naglakad kami sa gubat na mayabong ng mga punong-kahoy, at naramdaman namin ang sariwang hangin.

49. Kailangan kong harapin ang aking mga agam-agam upang hindi ako magpakita ng kahinaan.

50. Nakabalik na kami ni Maico galing sa pinagsanglaan ni Kuya.

Recent Searches

oftenbangkangpunoellavanmadalingsilyawantreadnakatigilasthmatodayclearreplaceddaladalatechnologicaltuwiderapipagpalitpinyuancommunicationspackagingomelettelasingerolimasawaimpactkamisetalayuninnapipilitanmagta-trabahocanteenwidespreadkalikasannagbabagapinaghihiwabrucemalapitipinalutoreboundhindipakelamerohusayinterestsanotherhumblemalasutlafanshereipinabalikwordsoperateagadresignationmakatulogmakapalagsasayawinsumindigoingmagdamaganfitnessspaphonenapakatagaltrenmakapaibabawwatchnapakamotnakaratingkamalayansmallkambingkuripotsasakayindustriyaadecuadoclientsnagpapantalsumamadumiwashingtonpanalanginbalatmaalalamayooftepinapakiramdamanbakitanongmakikipagsayawalagawingbornwalkie-talkiewikaviewmaaaringsponsorships,ulitreadingtog,boracaypinagmamasdantitashowcornerpinaglagablabseekputimangungudngodpesosalu-salooraskauna-unahangonlymayaflyvemaskinermaskluismaagataga-suportagaindogssongsreorganizingnakabaonbutibabenaibibigaypinagtabuyananyoakmapinagsikapan18thusepinagkasundoporibanagpasalamathasdadaeroplanes-allprobablementenakapamintanamakapagsalitamagpapabakunahinagud-hagodpinagsulatde-dekorasyonadditionally,nanunurisamang-paladpinauupahangpinamumunuanpaki-drawingpagpapasakitpakaininpagpapakalatpagkakakawitnangagsibilinahintakutanmakapagbigayiniintaymagsusunurankinamumuhiandenipinagbibilikinalimutanadditionallyvidenskabenteleviewingsignificantpinanalunanpara-parangpanatilihinpamamalakadpagkakamalipagkakahiwarabbadeclarepag-aapuhapnakakatakotnagpipikniknagpakilalanagpabakunatagaislanaglalatangnagkakamalinagagalithinalungkatvasquesmakakabalikkarangalanlegitimate,soonpagkakapagsalitaitlognatingnanahimikbayawak