Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "water"

1. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

2. Drinking enough water is essential for healthy eating.

3. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

4. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

5. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

6. Nag-aabang ang mga kabataan sa kalsada habang nagiigib ng balde-balde ng tubig para sa kanilang water balloon fight.

7. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

8. Sayang, tolong ambilkan aku air minum. (Darling, please get me a glass of water.)

9. The beach has a variety of water sports available, from surfing to kayaking.

Random Sentences

1.

2. Akala ko nung una.

3. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

4. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

5. Magkita po tayo pagbisita ko riyan.

6. Las hojas de mi planta de menta huelen muy bien.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8.

9. Ano ang ipinabalik mo sa waiter?

10. Ang pagdating ng malalakas na pag-ulan ay binulabog ang mga lansangan at nagdulot ng matinding pagbaha.

11. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

12. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

13. The company's CEO announced plans to acquire more assets in the coming years.

14. Ang pagkakaroon ng sapat na tulog ay nakakatulong sa pagpapanatili ng tamang timbang.

15. Cutting corners in your exercise routine can lead to injuries or poor results.

16. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

17. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

18. Magkano ang bili mo sa iyong cellphone?

19. The acquired assets included several patents and trademarks.

20. Some fruits, such as strawberries and pineapples, are naturally sweet.

21. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

22. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

23. The restaurant bill came out to a hefty sum.

24. Ahh.. sinuot na niya to tapos nag patuyo ng buhok.

25. Sana makatulong ang na-fund raise natin.

26. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

27. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

28. Ang aming angkan ay mayroong mga tradisyon sa pagdiriwang ng mga okasyon.

29. How I wonder what you are.

30. Sa isang tindahan sa may Baclaran.

31. Limitations can be perceived or real, and they can vary from person to person.

32. He is painting a picture.

33. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

34. Ano ang gustong sukatin ni Merlinda?

35. Working can provide a sense of purpose, achievement, and fulfillment.

36. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

37. Grabe naman ang lockdown na yan ilang buwan na.

38. At blive kvinde handler også om at udvikle sin personlighed og identitet.

39. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

40. Hiramin mo ang aking payong dahil umuulan ng malakas.

41. Sumaya ang mundo ni kuya dahil sa iyo.

42. pagkaraan ng kargang iyon ay uuwi na siya.

43. La tos puede ser tratada con medicamentos, como jarabes para la tos y expectorantes.

44. Ang mga mata niyang banlag ay animo'y laging gulat.

45. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

46.

47. Walang tigil sa paghalakhak ang matanda mula sa kanyang kinatatayuan.

48. Nakaakma ang mga bisig.

49. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

50. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

Recent Searches

knightwateryeypusasitawkriskakontingheartbreaksacrificesoccerbingitaaswalaniligawanscottishinterestssawaindiatarcilamakahingimarmaingsetyembrelandpriestsnoblutopeepcaredoktornumerosasbatokbusiness,televiewingestarbutihingnagbasalossmedidapisomakisigdagatryghedroonmaalogfurygranandamingsweettelangplaceisugamalagobataymagdaallowingmanuscriptmamidaandetbrucepyestacompartenbarrierstenpowernagreplyreducedfraabeneadverselyfeelboyetpetsatuwidfistsmatandasincescheduleinaliswalletenchantedbelievedputahenotemailelectionmalimitabstainingconcernschefseenbakestandferrercallemphasispagawainrestcontinuesmagkabilangnaroonelectronicsurveysteamitimbumabaresultsulinganibinigaynampalibhasapatingdamitworkingamountplatformbeyondlibagbroadcastsinvolvegenerationsqualitycommunicatebeforemuchflyrawnavigationprogramawhileexamplemakapilingefficientsyncclassesbehaviorthirdexistcurrenthighestwaitrememberamazonaccuracykumukuhasay,mahiyanag-iyakannakakatulongnamumulaklakkakuwentuhanmanamis-namiskagandahagpodcasts,naninirahansakristanhubad-baronagsagawanapakahusaynerohuertonakatapatteknologimagkaharapmawawalastrategiesnaliwanaganencuestasmababangishinihintaylungsodinuulampahiramsakyanwakaspinalambotsementeryoikatlongitinuloshinukaymatalimsisipaintengabigongskyldesamindiseasesmaongnagnakawelvisbecomingwordsnamustpamumunogawaingpulangtuloystruggledgathering