Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "early"

1. A quien madruga, Dios le ayuda. - The early bird catches the worm.

2. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

3. Cancer research and innovation have led to advances in treatment and early detection.

4. From its early days as a technology for the elite, to its current status as a staple in most

5. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

6. He's always the first one in the office because he believes in the early bird gets the worm.

7. I always wake up early to study because I know the early bird gets the worm.

8. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

9. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

10. I prefer to arrive early to job interviews because the early bird gets the worm.

11. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

12. I woke up early to call my mom and wish her a happy birthday.

13. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

14. If you want to get the best deals at the farmer's market, you have to be the early bird.

15. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

16. In the early days, telephones were connected to a central switchboard, which connected calls manually

17. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

18. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

19. She always submits her assignments early because she knows the early bird gets the worm.

20. She wakes up early every morning to exercise because she believes the early bird gets the worm.

21. She was feeling tired, and therefore decided to go to bed early.

22. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

23. The airport was busy, and therefore we had to arrive early to catch our flight.

24. The decision to release the product early was a risky but ultimately successful strategy.

25. The early bird catches the worm

26. The early bird catches the worm.

27. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

Random Sentences

1. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

2. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

3. Dahil sa ugali ni Aya na hindi maganda, siya ngayon ay kinaiinisan ng mga taong dati ay sa kanya pumupuri.

4. The community admires the volunteer efforts of local organizations.

5. Ibinigay ng titser ang libro sa estudyante.

6. All these years, I have been cherishing the relationships and connections that matter most to me.

7. Ipinaluto ko sa nanay ko ang pansit.

8. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

9. Waring malungkot siya ngayon, ngunit hindi niya sinasabi kung bakit.

10. Naglalaro siya ng video game nang biglang nabigla sa biglang pag-apoy ng computer.

11. May meeting ako sa opisina kahapon.

12. Hindi lahat ng kaibigan ay laging nandyan.

13. Dahil matamis ang dilaw na mangga.

14. El cultivo hidropónico permite el crecimiento de plantas sin utilizar suelo.

15. Tara! Sumama ka sa akin para makita mo kung gaano sila kaganda

16. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

17. The stock market can be used as a tool for generating wealth and creating long-term financial security.

18. Sa pagguhit, mahalaga ang pagpili ng tamang kasangkapan tulad ng lapis, papel, at krayola.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. There were a lot of flowers in the garden, creating a beautiful display of colors.

21. ¿Cuántos años tienes?

22. Marami silang pananim.

23. Sa sarili, nausal niyang sana'y huwag siya ang maging paksa ng paghaharutan at pagkakatuwaan ng mga agwador.

24. Les personnes ayant des antécédents de dépendance ou de problèmes de santé mentale peuvent être plus susceptibles de développer une dépendance au jeu.

25. When the blazing sun is gone

26. Cuando las plantas tienen al menos dos hojas, trasplántalas al lugar definitivo

27. Les enseignants sont responsables de la gestion de classe pour garantir un environnement propice à l'apprentissage.

28. Hindi maunawaan ni Bereti ngunit eksayted siya sa buhay nina Karing.

29. Have they fixed the issue with the software?

30. La conciencia puede hacernos sentir culpables cuando hacemos algo que sabemos que está mal.

31. Naku! Hindi pede, hindi akin yan eh. eh kay Chad yun eh.

32. Aray! nagcurve ball sya sa sakit sa sahig.

33. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

34. They are a member of the National Basketball Association (NBA) and play in the Western Conference's Pacific Division.

35. Tumawag ako kaninang umaga pero wala ka.

36. The hiking trail offers absolutely breathtaking views of the mountains.

37. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

38. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

39. Isang matandang lalaki naman ang tumikim sa bunga.

40. Sa ikauunlad ng bayan, disiplina ang kailangan.

41. Paano ho pumunta sa Manila Hotel?

42. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

43. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

44. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

45. Saan ang punta mo? nakapikit pa ng bahagya si Maico.

46. Nasa tabi ng ilog, pinagmamasdan niya ang mga isdang naglalaro sa tubig.

47. Ang mailap na kapalaran ay kailangan tanggapin at harapin ng may lakas ng loob.

48. Eh bakit hindi ka muna kasi bumili ng makakain mo?

49. Many cultures have their own unique traditions and customs surrounding weddings.

50. Ang kahirapan ay isang laganap na suliranin sa ating bansa.

Recent Searches

karaniwangearlymahahawalibrengumagangprocessnapaprospersinapokdividesmagtagogumantihawakanhumintotirahanparehasakodumilatnatulakinsteadyanamingregulargreaterwhethersatisfactionmadulasbateryadiliginpinatidpeksmanlungsodcuriouskumilosmanipisnicolaspumikitgraphicvariousaabsentsinapakipatuloyhumanapinaasahankumunotsharingbinibiligustingpag-asasellingcurrentmaputlakinagatginamitinsektolalapittumalonpatuloycynthiaacademymetodepadalaspaungolhigupinmasahollaganapkumalassalaoperatetumaholsugatanwhateverhawlalupaumingittoribiolikemaipantawid-gutomsumpainhatehighestmahigitsuedemahinogpumupuntapalasyogutomhapdiyumanigmaluwagaberginhawamagbagoschoolsbilihinutilizarkanyangdurantebugtonglumakasasimtobaccomemoriaoutpostkumirotvanhinigitmayroonjolibeestudiedwithoutinteractlangkaymabuhaypagbabagonakikini-kinitamahiramtelefonupokanayonnanditomag-aralsundalostarredginamotkabighadagligepalamutikuwentonanlilisikpassionklasengtermgalawsumapitnag-aasikasonabuhaybipolarpapuntalikelymonitoryoutubeumiinomlumapadmatapospumasokkanilaclientemagnifymamuhayakinmanuksoincluirnanangissumugodtiyonarinigtuluyangsinakoppalapithumansmahiwagangcomfortdomingonasahodsasambulattuluyaniniinomdeclaretumangoklasrumstuffedumamponmarilouinantokisinampayundeniablesiempretamarawsubjectsumahodnasilawrosellekawayanmakipag-barkadatulisanpinagpapaalalahanantilganglalabasmagtakapaggawapinangaralanmalawakinangatsisentakamalayanmasanaymamarilalapaapkabilis