Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "early"

1. A quien madruga, Dios le ayuda. - The early bird catches the worm.

2. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

3. Cancer research and innovation have led to advances in treatment and early detection.

4. From its early days as a technology for the elite, to its current status as a staple in most

5. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

6. He's always the first one in the office because he believes in the early bird gets the worm.

7. I always wake up early to study because I know the early bird gets the worm.

8. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

9. I learned early on that there's no such thing as a free lunch - everything comes with a cost.

10. I prefer to arrive early to job interviews because the early bird gets the worm.

11. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

12. I woke up early to call my mom and wish her a happy birthday.

13. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

14. If you want to get the best deals at the farmer's market, you have to be the early bird.

15. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

16. In the early days, telephones were connected to a central switchboard, which connected calls manually

17. Presley's early career was marked by his unique blend of musical styles, which drew on the influences of gospel, country, and blues

18. Regular check-ups with a healthcare provider can help to monitor blood pressure and detect high blood pressure early.

19. She always submits her assignments early because she knows the early bird gets the worm.

20. She wakes up early every morning to exercise because she believes the early bird gets the worm.

21. She was feeling tired, and therefore decided to go to bed early.

22. Some types of cancer have a higher survival rate than others, and early detection is crucial for successful treatment.

23. The airport was busy, and therefore we had to arrive early to catch our flight.

24. The decision to release the product early was a risky but ultimately successful strategy.

25. The early bird catches the worm

26. The early bird catches the worm.

27. The early bird gets the worm, but don't forget that the second mouse gets the cheese.

Random Sentences

1. El amor todo lo puede.

2. There were a lot of toys scattered around the room.

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

4. My best friend and I share the same birthday.

5. El actor hizo un comentario controversial que está llamando la atención de los medios.

6. Foreclosed properties may have liens or other encumbrances, which can complicate the purchase process.

7. La adicción a las drogas puede afectar negativamente las relaciones familiares y de amistad.

8. The rise of digital currencies and payment systems is changing the way people use and think about money.

9. Nagtaka ako kung bakit hindi pumasok ang guro sa klase ngayon.

10. mga yun. Ang mahalaga ay makapagempake ako agad.

11. Napagalitan si Juan dahil na-suway siya sa paglabag sa traffic rules.

12. At blive kvinde handler også om at udvikle sin personlighed og identitet.

13. Nagpatupad ang mga pulis ng checkpoint upang mahuli ang mga posibleng salarin.

14. Nakakatuwang malaman na maraming kabataan pa rin ang nakikinig at nakakatuklas ng kagandahan ng mga kanta ng Bukas Palad.

15. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

16. Tumamis at sumarap ang lasa ng bunga.

17. When in Rome, do as the Romans do.

18. They served a mouthwatering strawberry shortcake for dessert.

19. Comer regularmente comidas pequeñas y saludables durante todo el día puede ayudar a mantener niveles de energía estables.

20. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

21. Ano ang ginugunita sa Thanksgiving Day?

22. Itinuring nila itong kapamilya at nakatulong pa kay Roque sa pang-araw-araw na pahahanap ng pagkain.

23. A wedding is a ceremony in which two people are united in marriage.

24. La salsa de chile es una de mis favoritas, me gusta el sabor picante.

25. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

26. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

27. Siya ay laging nagmamalabis sa pag-aaksaya ng pera para sa mga luho.

28. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

29. The Wizard of Oz follows Dorothy and her friends—a scarecrow, tin man, and lion—as they seek the wizard's help to find their true desires.

30. Agradezco profundamente tu dedicación y esfuerzo.

31. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

32. Tatanghaliin na naman bago siya makasahod.

33. The stock market is a platform for buying and selling shares of publicly traded companies.

34. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

35. Have they visited Paris before?

36. Ayam goreng adalah ayam yang digoreng dengan bumbu khas Indonesia hingga renyah.

37. Christmas is a time for giving, with many people volunteering or donating to charitable causes to help those in need.

38. Ang mga firefighter nagsisilbi upang protektahan ang mga tao mula sa mga sunog.

39. Umalis siya papuntang Cebu kahapon ng hapon.

40. Hindi dapat natin kalimutan ang ating mga pangarap kahit na may mga pagsubok sa ating buhay.

41. Nais kong mapasigla ang aking katawan kaya kailangan ko ng mahabang halinghing.

42. Ginaganap ang linggo ng wika ng Agosto.

43. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

44. Kailangan kong harapin ang aking mga agam-agam upang hindi ako magpakita ng kahinaan.

45. Ayos lang. Basta alam kong safe kang nakauwi.

46. Nag-iisa man siya, hindi siya nawawalan ng pag-asa.

47. Napaluhod siya sa madulas na semento.

48. Nakaupo ang babaeng nakasuot ng salamin.

49. Los recién nacidos son pequeños y frágiles, pero llenan nuestros corazones de amor.

50. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

Recent Searches

earlyinfluenceshamoncebuhighestanigumulongpanggatongreleasedpanalangincliptinanggapgoodeveningyespantallascoachingdisenyongmaagapanatagiliranboxingmagitingpagbabantamalungkotyungiyonbinatonatigilanlaybrarilumalakibranchesnapilitanferrernagpasamapinalalayastagiliranpasasalamatboxwidelysilyamaluwagperokanserkakapanooddonationspagkatikimendvidereutak-biyapanignapakalakimamimilinag-aalangannapuputolmaliitnaapektuhancoatmakalapitpagpasokpinapaloibinalitangkamaohinintayclimbedtamagawaninalisutakinfinitymahihirapeventspagtitiponprogressfollowingnapatigilkisapmataabstainingnagkalatnananalongmatanggapipaghugasinintaypamumunobuhawimakasamamaya-mayakuwebanatitiraanywherenagbabalakangkongdumapaenglishubos-lakasphysicalabigaelrambutanlumungkottoribionabagalanibahagisimbahabahagyabahagiexistsicapahingalguidancepatigiyeranakapuntapagigingencuestaskuwartongnangyaribahapamasaheleksiyonmagsusuotinternetrailwaysmembersisusuotmahabangmagsunognapansinnakasilongna-suwaypataykamisetakasiyahankasiyahangmamayanutrientes,bukasresearch:pinatawaddrinkresearch,umiiyakubodnagpakitaumiyaknaiyakiiyakngunitbiyakmagkasintahankasingnutrienteslacsamanalaryngitisresearchnagsisilbipalengkemagandasinimulangawiniyakpalikurannakayukoipinagdiriwangkasibangkongnitonggagamitinnagsisigawchoirnatutuwabilaokutsaritangnagpapasasakara-karakapaghusayansumusulatpumupuntanangyayarimaghaponsiksikantumahimikfitnesshinahanapfirstpowerpointhumahangosefficientginagawanaghihinagpisbreakkatawantenderkinabukasancountrymalinisaudiencematindingnalagutanmamimissisuotwashingtonkawayankanluran