Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "however"

1. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

2. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

3. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

4. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

5. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

6. However, there are also concerns about the impact of technology on society

7. However, there are also concerns about the impact of the telephone on society

8. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

9. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Nagtatrabaho ako sa Youth Center.

2. Users can follow other accounts to see their tweets in their timeline.

3.

4. Ang pangamba ay kadalasang sanhi ng hindi pagpapakatotoo sa ating mga nararamdaman at saloobin.

5. Nagtatanim ako ng mga gulay sa aking maliit na taniman.

6. Busog pa ako, kakatapos ko lang mag merienda.

7. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

8. A, e, nawawala ho ang aking pitaka, wala sa loob na sagot ni Aling Marta

9. Sa ganang iyo, may katuturan ba ang kanyang paliwanag sa harap ng hukom?

10. Ang bawat isa ay may bahagi sa pagpapabuti ng bayan.

11. La novela produjo una gran empatía en el lector hacia los personajes.

12. Football players must have good ball control, as well as strong kicking and passing skills.

13. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

14. Isang matandang lalaki naman ang tumikim sa bunga.

15. Hay miles de especies de serpientes en todo el mundo, con una amplia variedad de tamaños, colores y hábitats.

16. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

17. Masasaktan ka kung malalim na babasagin niya ang kaibuturan ng iyong pagkatao.

18. Dahil sa globalisasyon, lubos na umangat ang teknolohiya ng maraming bansa.

19. Ang pagbibigay ng ampao ay isang tradisyonal na paraan ng pagpapakita ng paggalang sa matatanda sa Chinese New Year.

20. Give someone the benefit of the doubt

21. La música puede ser una forma de protesta y expresión de descontento.

22. Saan naman? nagtatakang tanong ko.

23. May nanganganib na mawalan ng trabaho dahil sa aksidente na nangyari sa paggawa ng proyekto.

24. Nagsusulat ako ng mga pangalan sa aking kalendaryo upang hindi ko sila malimutan.

25. Masyadong maluwang ang pantalon na ito.

26. Sa pagdating ng suporta ng aking mga kaibigan, ang aking pag-aalala ay napawi.

27. I am working on a project for work.

28. Limitations can be viewed as opportunities for growth and personal development.

29. The introduction of the dial telephone in the 1920s further improved the telephone system, as it allowed for faster and more efficient call connections

30. Sa gitna ng paglalakad sa kalsada, huwag magpabaya sa kaligtasan at sumunod sa mga traffic rules.

31. Naalala niya ang itinuturo ng misyunero na si Hesus daw ay muling nabuhay pagkalipas ng tatlong araw

32. Kleine Geschenke erhalten die Freundschaft.

33. Ang pagtangging harapin ang mga hindi kanais-nais na katotohanan ay nagpapakita ng pagiging bulag sa katotohanan.

34. Despues de cosechar, deja que el maíz se seque al sol durante unos días antes de retirar las hojas y las espigas

35. Wenn die Inflation zu schnell ansteigt, kann dies zu einer Wirtschaftskrise führen.

36. Hindi. Ipinangangak ako sa Cebu.

37. Børns leg og kreativitet er en vigtig del af deres udvikling.

38. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

39. Las escuelas se dividen en diferentes niveles, como primaria, secundaria y preparatoria.

40. The park has a variety of trails, suitable for different levels of hikers.

41. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

42. Les étudiants doivent respecter les règles de conduite à l'école.

43. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

44. Nasa banyo siya nang biglang nabigla sa tunog ng pagbagsak ng isang kahon.

45. Les étudiants peuvent poursuivre des études supérieures après l'obtention de leur diplôme.

46. Gumising ka na. Mataas na ang araw.

47. Vi skal fejre vores helte og takke dem for deres indsats.

48. La santé mentale est tout aussi importante que la santé physique.

49. The patient's immune system was compromised due to their leukemia, and they were advised to take extra precautions to avoid infections.

50. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

Recent Searches

langdaigdigpapuntahowevereksenaheifistsofferkalawangingwristumaasakapilingdecreasedoesdevelopmentexamplebehaviorsolidifyableformatquicklywhetheruponrelievedpaki-drawingkawawangnagsunuranpagpapasandaraanmaaamongnahantadmagtatampopresidentpawiinvillagetemparaturakakapanoodsumusulatmakakabalikwatawatmaipapautangmadridumokaymatitigaspagiisipnakabasagincitamenterpasyenteincluirsaan-saantumawakaharianengkantadangverden,lever,tabingvaccinesnagdadasallumilipadduwendemaputlamagdalakanilaleegbillkamandagmenspinakamatapatkeephanmatalimdulangisimay-bahayroofstockpalikuranhongprocessesgubatsarisaringbihirangwriting,siyudadkamaliannagta-trabahonatuyotaon-taonpagkaingdi-kalayuanipinanganaksuccesshappiernayonparanglaganapnakaratingresignationparkingsalamangkerat-isalinawangkoprequiresmaluwangmaiingayilangsellingreviewnakakuhatimeneedsmovielumangplatformemocioneswalngnagngangalangpagbubuhatanmakingkokakprotestabalitaquezonphilosophykinuskosechaveewannakakatabasimbahanpinanawanmagpalibrestarted:nanlalamigsquashkuwadernoaberharapinnagtalagamaluwagcantidadkisapmataulihanapbuhayanak-mahirapsuriinnaaalalanagbiyahenagtinginanmaskinersumpungindumadatingnaliwanagankabiyaklakadtalinokatagalanmagawanghitorkidyasalasskypepinagkasundonagtuloymalihisnaglalatangsusulitiniwannatigilannangingitianlingidbilaoulampagsisimbangmalamanbilinpagodbernardoayudabakitdedication,bagyongjustboyetwaaabrucehanggangproveprovideinternakumakalansingmanamis-namispalabuy-laboymagbabakasyonpuntaimpactedsegundorobertmakapagmanehomagkasing-edadmagbubunga