Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "however"

1. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

2. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

3. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

4. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

5. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

6. However, there are also concerns about the impact of technology on society

7. However, there are also concerns about the impact of the telephone on society

8. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

9. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Cryptocurrency has faced regulatory challenges in many countries.

2. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

3. Iyon ang totoo, sinasabi niya sa sarili.

4. Bilang paglilinaw, ang event ay para sa lahat, hindi lang sa mga miyembro ng organisasyon.

5. Nakangiting tumango ako sa kanya.

6. Hindi pinakinggan ng Ada ang abuhing Buto ng Kasoy.

7. Sa pangkat na iyon ay kay Ogor agad natutok ang kanyang tingin.

8. Musk has been described as a visionary and a disruptor in the business world.

9. If you're looking for the key to the office, you're barking up the wrong tree - it's in the drawer.

10. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

11. Limitations can be a source of motivation to push oneself to achieve more.

12. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

13. Hindi. Ipinangangak ako sa Cebu.

14. I sent my friend a bouquet of flowers and a card that said "happy birthday."

15. Parang nahulaan ng kanyang ina ang kanyang iniisip.

16. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

17. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

18. Ang paglapastangan sa mga relihiyosong simbolo ay labag sa mga patakaran ng paggalang sa iba.

19. Maging si Amba ay natulala sa mahirap na disenyong nagawa ng matanda.

20. Yey! Thank you Jacky! The best ka talaga!

21. A couple of songs from the 80s played on the radio.

22. Habang nglalaba si Aling Rosa at iba pang may-bahay ay masayang nalalaro at naliligo ang mga bata.

23. Mahalagang magbigay ng respeto sa bawat isa, samakatuwid.

24. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

25. Ang mga kawani sa serbisyo-publiko ay dapat na itinuring bilang mga tagapaglingkod ng bayan.

26. Ang pagiging malilimutin ni Tina ay minsang nagiging dahilan ng kanyang pagkahuli.

27. Ang mailap na kaharian ay kailangan paghirapan upang mapasakamay.

28. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

29. Una buena conciencia nos da una sensación de paz y satisfacción.

30. Ang talambuhay ni Juan Ponce Enrile ay nagpapakita ng kanyang malawak na karanasan sa pulitika at pamumuno.

31. Nagsusulat ako ng mga kwento at mga katha upang palawakin ang aking imahinasyon.

32. Saya tidak setuju. - I don't agree.

33. The beauty store has a variety of skincare products, from cleansers to moisturizers.

34. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

35. Les comportements à risque tels que la consommation

36. Nakakaanim na karga na si Impen.

37. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

38. OMG. Makalaglag-panty si Kuya!!

39. Tanging si Kablan ang may tindahan sa kanilang komunidad.

40. Pagkatapos siyang kausapin ng hari ay dumeretso si Nicolas sa simbahan at siya ay nagdasal.

41. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

42. Smoking can be addictive due to the nicotine content in tobacco products.

43. Sa pagbabasa ng magandang libro, napapasaya at natutulog ako nang matiwasay sa gabi.

44. Ang mga ibon ay wala nga namang mga pangil tulad nila kaya isinama din nila ito sa pagdiriwang.

45. Indonesia dikenal dengan pantai-pantainya yang indah dan airnya yang jernih, seperti Bali, Lombok, dan Gili Islands.

46. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

47. Sa sobrang dami ng mga dapat gawin, may mga pagkakataon na naglilimot siya sa ilang mga mahahalagang mga takdang-aralin.

48. Si Aguinaldo ay kinikilala bilang isa sa mga pinakamahalagang bayani ng Pilipinas.

49. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

50. He does not argue with his colleagues.

Recent Searches

howeverfacilitatingconectanmapadalioftebubonginfluentialtuwidspeedellenauditcablerelevantcircleonlyslavefencingflymonetizinginilingchecksseenitinuringfilmnangingilidubokainanmeanssakimkasamaangdiversidadnasaktandeliciosadispositivoskuwartomagtanimpagbahingmakinangaraytechniquestumayowakasmejoginisingbaryongunitmagkakailamanghikayatmahabadistansyanaglalatangbiocombustiblesmakalaglag-pantybandakasuutanganitosaan-saanheartbeatpalapagnahulisweetbatoginangstaplecivilizationpagkamulatniyanapatingalatoretetwitchdipang1920skubyertossupilingreennagtatampokinagagalaknakatayolumalangoyspirituallumiwagkalakihannakakasamamusiciandahilelectionmananalonami-misspinapataposnakatindiglumamangpumapaligidrevolutioneretpanghihiyangmahiwagangpamahalaanperformanceknightevolucionadopartsnahahalinhannapatulalamagbibigayproductividadinaabutanmagpapagupitpinagkiskisminu-minutokailanmanininomnanamanlumindollayassaranagisingtrajeathenawednesdayiguhitmaghatinggabitenidomartiannagniningningnamilipitramdamnatitirangangpatongsiralinatilisignmatakawnuhtinitirhannaiinitanlinawlintapanosuotbingicassandragalawtinaposgreatspareresignationfar-reachingnagbasaresortnitongtingschoolslegendsatentosumasambalotpinadalamalabobotedolyarcongratsouehumanonameprivatedahonlinefansaksiyoncomunicarsereallyincreasespuntanasundorobertespanyolsinabireportibonakiniglapimporbesidesmournedhinahaplosnasasakupanteachercurtainsjobsgoodeveningnakakadalawthanksbumangondawnatakottransportbibigyanasahanada