Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "however"

1. However, concerns have been raised about the potential impact of AI algorithms on jobs and society as a whole.

2. However, excessive caffeine consumption can cause anxiety, insomnia, and other negative side effects.

3. However, investing also carries risk, as the value of investments can fluctuate and can result in losses.

4. However, it is important to note that excessive coffee consumption can also have negative health effects, such as increasing the risk of heart disease.

5. However, the quality of the data used to train AI algorithms is crucial, as biased or incomplete data can lead to inaccurate predictions and decisions.

6. However, there are also concerns about the impact of technology on society

7. However, there are also concerns about the impact of the telephone on society

8. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

9. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

Random Sentences

1. Alas-tres kinse na ng hapon.

2. Nagsisikain ang mga bata ng tinapay.

3. Ani Karing ay naiinggit ito kay Bereti dahil nakukuha ang lahat ng gusto.

4. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

5. Microscopes require careful handling and maintenance to ensure accurate results.

6. Tumakbo na ako para mahabol ko si Athena.

7. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

8. A successful marriage often requires open communication and mutual respect between a husband and wife.

9. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

10. Ibinigay ni Ana ang susi sa kanya.

11. Wala na siguro sya, baka natulog na inantok na.

12. Ang sundalo ay nangahas na tumayo sa gitna ng labanan upang iligtas ang isang sugatang kasama.

13. Tsong, hindi ako bingi, wag kang sumigaw.

14. El arte abstracto tiene una simplicidad sublime que pocos pueden entender.

15. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

16. Las redes sociales pueden ser un lugar para encontrar y unirse a comunidades de intereses comunes.

17. The DNA evidence led to the arrest of the culprit in the murder case.

18. Hindi matatawaran ang hinagpis ng mga magulang na nawalan ng kanilang anak sa digmaan.

19. Naghahanap ako ng kailangang gamitin at hinugot ko mula sa baul ang mga ito.

20. Keluarga sering kali memberikan hadiah atau uang sebagai bentuk ucapan selamat kepada ibu dan bayi yang baru lahir.

21. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

22. Halos de-lata na lang ang lagi nitong inuulam.

23. Dumating ang pangulo sa pagtitipon.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Une alimentation équilibrée et une activité physique régulière sont des éléments clés pour maintenir une bonne santé.

26. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

27. Nagtatrabaho ako sa Student Center.

28. Kumain ako ng sinigang sa restawran.

29. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

30. Walang 'tayo' Maico. Kaya please lang iwan mo na ako.

31. Hihiga na sana ako nang may kumatok sa pinto.

32. Binentahan ni Aling Maria ng prutas si Katie.

33. Ano kaya ang pakiramdam ng nakasakay sa eroplano.

34. Umayos ka nga! Wala ka sa bahay!

35. Hun er utrolig smuk. (She is incredibly beautiful.)

36. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

37. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

38. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

39. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

40. Matapos magbabala ay itinaas ng matanda ang baston.

41. Ok lang ba to? Baka naman magalit si Abi.

42. Siya si Helena, nag-iisang anak siya nina Haring Bernardo at Reyna Lorena.

43. L'auto-évaluation régulière et la mise à jour de ses objectifs peuvent également aider à maintenir une motivation constante.

44. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

45. Naglalaro ang walong bata sa kalye.

46. Kain na tayo. yaya ni Maico sa amin.

47. Ipinakita nya ang determinasyon sa larangan ng boxing.

48. Aling lugar sa lungsod mo ang matao?

49. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

50. Sino ang kasama niya sa trabaho?

Recent Searches

howevervistrainingtargetpapuntabeenmapakalipasswordbornuniquebabaprocessamazoneffectreadinterviewingnotebookcountlessflyrawbitawanpasangknowsbadendbirthdayuniversalbinilingikinalulungkotngumitikomedornanahimiknananaghilinaghihiraptahimiktog,usuarionaninirahanbilitangangraphicreachsiyamargueseniorencompassesburmaalas-dosguiltymagta-taxiipagtimplanagtaasserviceswhynakapaligidbagkusnaglalakadna-fundincluirlabornakasumagotbreaksatisfactionexpectationsfraomelettepootbarangayphilippinemakapangyarihangkalalakihanalas-diyeskasuutanpagtutolmarurumipagpapatubonagkakakainanumangaustralianagtagpobotongnapakamethodsexplainquicklyalignsoffentlighimselfpeaceiiwanpundidocultivationcualquierengkantadangressourcernenagpapaigibpangyayariitokarunungandahan-dahancarsnagtutulakpacienciaibat-ibangkumidlatnawawalainspirationsurveysalanganpinansinpersoninspirebanlagentertainmentbunutanahasbrasoantoksellingpalayaniyacomputere,busyblusahydelunderholderbuslocomienzangranadaballbelievednathansorrytenincludefacultycablebeginningnilutotanimibalikingatanbarogrinsbansapag-aaralangnagdudumalingsuccessnapaplastikanmurang-muranagulatpinakamatabangmarketplaceslihimginawarankaninonovellesmabihisanmakasakayi-rechargenakadapanabighanipanghabambuhayendviderenatakotmisyunerongpinisilincitamenternakabiladmalilimutanengkantadakanayangipinambilihoynatagalanmayabongnapapikitlabahinsentencebestkulotcarmenadvancebuslacksumalidyanbarrierssteerhimigeyeparatinginalismessagegenerateddumaramiprovidedmediummarunong