Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "modern"

1. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

2. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

3. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

4. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

5. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

6. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

7. Kings have held power throughout human history, from ancient civilizations to modern times.

8. Microscopes have played a critical role in the development of modern medicine and scientific research.

9. Modern civilization is based upon the use of machines

10. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

11. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

12. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

13. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

14. Television is one of the many wonders of modern science and technology.

15. The library has a variety of books to choose from, ranging from classics to modern literature.

16. The website's design is sleek and modern, making it visually appealing to users.

Random Sentences

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

2. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

3. Magtatampo na ako niyan. seryosong sabi niya.

4. We've been avoiding the elephant in the room for too long - it's time to face the music and deal with our challenges.

5. Helte kan have en positiv indflydelse på hele samfundet.

6. Biglang nagulat ang bata nang lumitaw sa harp niya ang isang duwende.

7. Football can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

8. Hihiga na sana ako nang may kumatok sa pinto.

9. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

10. Hello. Ito po ba ang Philippine Bank?

11. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

12. Maraming Salamat!

13. Ininom ni Henry ang kape sa kusina.

14. Walang matigas na tinapay sa gutom na tao.

15. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

16. Muli niyang itinaas ang kamay.

17. Women have often been the primary caregivers for children and elderly family members.

18. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

19. El acceso al agua potable es un derecho humano fundamental.

20. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

21. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

22. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng tamang pag-iisip, kaalaman, at tiyaga.

23. Limitations can be frustrating and may cause feelings of disappointment and failure.

24. Magtanim ka nga ng mga puno dyan sa garden.

25. Der er mange traditionelle ritualer og ceremonier forbundet med at blive kvinde i forskellige kulturer.

26. Magkaiba ang ugali nila, si Amparo ay tamad at walang kinagigiliwang gawin kundi ang lumapit sa mga bulaklak at amuyin ito.

27. La creatividad se puede aplicar en cualquier campo de trabajo.

28. He pursued an "America First" agenda, advocating for trade protectionism and prioritizing domestic interests.

29. Maganda ang pakiramdam kapag mayroon kang kaulayaw na makakasama sa buhay.

30. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

31. Shaquille O'Neal was a dominant center known for his size and strength.

32. Sa gitna ng pagluluto, nagitla ako nang biglang mag-expire ang gasera.

33. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

34. Nakita kita sa isang magasin.

35. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

36. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

37. Ada beberapa tradisi dan kepercayaan terkait kelahiran di Indonesia, seperti menjaga diri dan pola makan selama masa kehamilan.

38. The doctor recommended a low-fat, low-sodium diet to manage high blood pressure.

39. Napakaganda ng loob ng kweba.

40. Inflation kann sowohl kurz- als auch langfristige Auswirkungen auf die Wirtschaft haben.

41. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

42. Nasa ganito siyang kalagayan nang bigla niyang maramdaman ang isang ubos-lakas na sipa sa kanyang pigi.

43. If you want to get the best deals at the farmer's market, you have to be the early bird.

44. Kailan nangyari ang aksidente?

45. Ramon, nanaisin ko pa na sila'y magbagong-anyo kaysa tuluyang mawala na sa atin.

46. Maarte siya sa pagpili ng kanyang mga kaibigan kaya hindi siya basta-basta nakikipag-usap sa mga tao.

47. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

48. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

49. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

50. Gracias por creer en mí incluso cuando dudaba de mí mismo/a.

Similar Words

moderne

Recent Searches

roomdollyrepresentativemodernkablanpropensolamangbuslotaingalossbairdshopeediagnosticmaluwangeasiernewspaperscorapinapanoodpagitanmag-iikasiyamsigfansipinagbilingtabihitjoyadditionallyclassroombellrestawankwebangmatchingmatindingbalewidenabanggamartianrequireeditorsigningsinfinitymanagerdoingbilingdecreaseresponsiblejunioeffectsdadalhinabscouldallowedbathalamumuradyipmagitingumigtadnakalagaymapadalijuanamangebalakiskedyulbinibinisumalakaysanggolkinukuhabotongbefolkningensumasayawhashistoriaspersonalorderluneseasylargernabuhaytarcilanakapapasongpaglisanpamburahumahangosbisikletabastanasilawsteamshipskaninaliligawannagtapossetyembrepinagmamasdanpiyanosuriinasukalkaraniwangbayanigusalinaglabamitigatemagbantaymesangkauntipalagingprocesogovernmentnicepasasalamatdahilbakapunongkahoyisinaboymbricospambahayraisepag-iinatdagapaosryankakataposnatitirapinakamagalingumibiggulatmalambingnagaganappaninigasguitarramakamitligayasasapakinnasuklamipinansasahogsikipricoresignationparoroonasumimangotkaramihandidingkararatingphilippinenagnakawkanginaparaangelvismagkaibiganpakisabiseguridadtalagainventadonahulognamumutlageneratedmantikalaganappssscandidatesperyahannagtatanongbefolkningen,ikinatatakotnabigaymarangyangpagpapakilalaumupohimayinhinaboltagaroonistasyonbutaskikomagigitingeneroiniibigvitaminjackzramdamtransmitidasunosnaghuhumindigmamalasumakbaynapakahusaypinakabatangpagsumamonakasuotnalalaglagfilmpodcasts,nagkitanakapamintanacultivonakakapagpatibaypagkakatayokaklaseguerrerowaterdaigdigbiler