Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "modern"

1. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

2. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

3. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

4. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

5. It has revolutionized the way we communicate and has played a crucial role in shaping modern society

6. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

7. Kings have held power throughout human history, from ancient civilizations to modern times.

8. Microscopes have played a critical role in the development of modern medicine and scientific research.

9. Modern civilization is based upon the use of machines

10. Nationalism has been a powerful force in shaping the modern world, particularly in the aftermath of colonialism.

11. Nationalism has been an important factor in the formation of modern states and the boundaries between them.

12. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

13. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

14. Television is one of the many wonders of modern science and technology.

15. The library has a variety of books to choose from, ranging from classics to modern literature.

16. The website's design is sleek and modern, making it visually appealing to users.

Random Sentences

1. Bumalik siya sa Pilipinas nang biglaan dahil may emergency sa kanilang pamilya.

2. Sa bawat tagumpay, dapat tayong magpasalamat at magbigay ng pagkilala sa mga taong tumulong sa atin, samakatuwid.

3. Pupunta ako sa Madrid sa tag-araw.

4. May pista sa susunod na linggo.

5. Coffee has been shown to have several potential health benefits, including reducing the risk of type 2 diabetes and Parkinson's disease.

6. Ako ay bumili ng lapis sa tindahan

7. Uuwi si Ellen sa Cebu sa Pasko.

8. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

9. Viruses can mutate and evolve rapidly, which can make them difficult to treat and prevent.

10. Nagsasagawa ako ng mga pagsisikap upang maging maganda ang impression ng aking nililigawan sa akin.

11. Hindi ako sang-ayon sa mga desisyon ng aking mga magulang tungkol sa aking buhay.

12. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

13. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

14. Television has a rich history, and its impact on society is far-reaching and complex

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. May I know your name so I can properly address you?

17. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

18. Baka nga si Amba pa gumawa ng tela aniya.

19. El lienzo es la superficie más común utilizada para la pintura.

20. Masakit man aminin, hindi maiiwasan na mag-inis tayo sa mga taong nakapaligid sa atin.

21.

22. Ang malalakas na hagupit ng hangin sa gitna ng bagyo ay binulabog ang mga puno at nagdulot ng pagkasira sa mga istraktura.

23. Si Juan ay napakagaling mag drawing.

24. Nagdiriwang sila ng araw ng kalayaan.

25. Alam kong parang biglaan, pero sana pwede ba kita makilala?

26. Nakakamiss kumain ng pulotgata tuwing tag-araw kasama ng pamilya.

27. We have a lot of work to do before the deadline.

28. This has led to increased trade and commerce, as well as greater mobility for individuals

29. Wala naman. I think she likes you. Obvious naman di ba?

30. Sa iyong pagdating, lumiwanag ang aking mundo.

31. Baka sakaling magbago si Aya kung ito ay isa na ring ina.

32. Sinikap niyang kumbinsihin ang mga katutubo upang maging Katoliko.

33. Nagreklamo ako tungkol sa pakete ko.

34. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

35. Drømme kan inspirere os til at tage risici og prøve nye ting.

36. Tantangan hidup adalah kesempatan untuk belajar, tumbuh, dan mengembangkan ketahanan diri.

37. Halos lahat ng mga misa sa aming parokya ay may awiting Bukas Palad.

38. May mga punong-kahoy na pinaniniwalaang matatanda nang bago pa dumating ang mga kolonizador.

39. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

40. Uncertainty can create opportunities for growth and development.

41. Nagsmile siya sa akin, Bilib ka na ba sa akin?

42. Humingi siya ng makakain.

43. Ang snob naman neto. Alam mo ba kung anong oras na?

44. Einstein was a vocal critic of Nazi Germany and fled to the United States in 1933.

45. Kaya't iyon ang naging dahilan kung bakit kinamumuhian niya ang kanayang ama at itinuring na patay na ito

46. Many people go to Boracay in the summer.

47. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

48. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

49. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

50. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

Similar Words

moderne

Recent Searches

taposmahahabamodernabrilhojassally1876sinapakgatherisinalangmrsarbejderfonoshumiwatanimsparkt-shirtlibertykastilahinalungkatemocionespag-akyatpalayobipolargabewordstools,barriersaalishistoriaso-calledjackzwalangaccedersumamaipagbiliconectadosboksingtalatiningnanradyonapagnakasunodkikilosisisingitinfluentialellentuwidsumasakayspeedsumapitnutrientesandkiloellacigarettesnagreplyimaginationbalegeneratedilingdumaramiabledraft,inteligentesannaumilingmichaelcleanbackactivitychefconsiderarbabakasiklimamerlindawastogamedesisyonancommunitysponsorships,kahilingansiglapasalubongsamantalanglegendo-orderposts,recordedgreenminamadalikapatidpamahalaaneffektivnabalotirogmacadamiautilizambalokalabawmaipapautangkuwadernotumatanglawmaramipagdidilimmusiccombatirlas,matatawagtaonpangungutyadumadatingnoongtsaacomputerebilaoinangotsoredshinestaosakinvedpagtitiponnatagopeksmanngayondarnabyggetakmanginiangatpetroleumeveningmailapayonginagawamarurumiabuhingkumaenlaamangbiglaanyeheywordtagpiangnasaanexperience,naglalabaeuphorickatagangilangtigilnamingnagpipiknikhehepamasahebatang-batadumagundongtinaasboypicshinintaydadacineunti-untingbagnangsapotkaugnayantumabitechnologieswasakredessalepumupuntamatikmankartonmagkapatidwalletclientebugtongracialnagugutomhojas,allergylumampasnakatinginbangkongmaghahandalabingmorenafuncionesbroadprogrammingmangangahoyiligtaspag-aalalapalamasayahininspirasyondiretsahang