Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "every"

1. "Every dog has its day."

2. A portion of the company's profits is allocated for charitable activities every year.

3. By the way, when I say 'minsan' it means every minute.

4. Congress are elected every two years in a process known as a midterm election

5. Every cloud has a silver lining

6. Every year on April Fool's, my dad pretends to have forgotten my mom's birthday - it's a running joke in our family.

7. Every year, I have a big party for my birthday.

8. He gives his girlfriend flowers every month.

9. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

10. I have been jogging every day for a week.

11. I set my alarm for 5am every day because I truly believe the early bird gets the worm.

12. Los sueños nos dan una razón para levantarnos cada mañana y hacer lo mejor que podemos. (Dreams give us a reason to get up every morning and do our best.)

13. My grandfather used to tell me to "break a leg" before every soccer game I played.

14. No hay mal que por bien no venga. - Every cloud has a silver lining.

15. She has been exercising every day for a month.

16. She has been running a marathon every year for a decade.

17. She wakes up early every morning to exercise because she believes the early bird gets the worm.

18. The President is elected every four years through a process known as the presidential election

19. They go to the gym every evening.

20. They walk to the park every day.

Random Sentences

1. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

2. The argument was really just a storm in a teacup - it wasn't worth getting upset over.

3. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

4. La poesía de Neruda tiene una elegancia sublime que conmueve al lector.

5. Masasaya ang mga tao.

6. They are not singing a song.

7. Kahit pagod ka na sa trabaho, nakakarelax ang paglalakad sa dapit-hapon.

8. Aller Anfang ist schwer.

9. The COVID-19 pandemic has brought widespread attention to the impact of viruses on global health and the need for effective treatments and vaccines.

10. Gaano katagal ho kung maglalakad ako?

11. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

12. Dahil sa pag pupursigi, maganda ang naging resulta ng exam ni Marie.

13. Pakilagay mo nga ang bulaklak sa mesa.

14. Lakad pagong ang prusisyon.

15. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

16. I can't keep it a secret any longer, I'm going to spill the beans.

17. Tila nagtatampo siya dahil hindi mo siya kinausap kanina.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

20. The children do not misbehave in class.

21. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

22. Bilang paglilinaw, hindi ako ang nagsimula ng usapan, ako lang ang sumagot sa tanong.

23. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

24. At ang hawak nitong bangos na tig-bebeinte.

25. Palibhasa hindi niya kasi malaman kung mahahanay ba siya na isang mabangis na hayop o di kaya'y ibon.

26. Kumikinig ang kanyang ulo at nangangalit ang kanyang ngipin.

27. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

28. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

29. Sumimangot ako at humarap ulit sa labas.

30. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

31. Si Jose ay na-suway sa simpleng paalala na huwag mangulangot sa harap ng ibang tao.

32. May I know your name so I can properly address you?

33. Doa juga dapat dijadikan sarana untuk memohon perlindungan dan keberkahan dari Tuhan.

34. Dedication is the commitment and perseverance towards achieving a goal or purpose.

35. Si Carlos Yulo ang unang Filipino gymnast na nakakuha ng gintong medalya sa World Championships.

36. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

37. Beauty! yumakap pa mula sa likod ko si Maico.

38. I am absolutely determined to achieve my goals.

39. They have seen the Northern Lights.

40. Bigyan mo ng pera ang pulubi.

41. Gusto kong bumili ng bestida.

42. Hindi maganda ang pagmamalabis sa trabaho dahil maaaring magdulot ito ng pagkaburnout.

43. Elektronik kan være en kilde til underholdning og sjov.

44. Los héroes pueden ser tanto figuras históricas como personas comunes que realizan actos heroicos en su vida cotidiana.

45. Sa bawat kompetisyon, dala ni Hidilyn Diaz ang pagmamalaki at pagmamahal niya sa Pilipinas.

46. Wag kang tumabi sakin! paguutos nito.

47. Después de leer el libro, escribí una reseña en línea.

48. Don't waste your money on that souvenir, they're a dime a dozen in the market.

49. Ano ang sinabi ni Antonio Tinio?

50. Beth ang pangalan ng matalik kong kaibigan.

Similar Words

everything

Recent Searches

everycasesburdenincludedataerrors,efficientevolvedcreatemaptopicclockulotabawhetherpacekasingbwahahahahahapartyconsideredbahalapaglakipag-akyatejecutanmatitigaspaghihiraplayuannapakabilisumakyatpuntamakapaniwalasaradisposalareasdingdingnalulungkotnakatayoyoutube,magsusuotuugod-ugodpalibhasangumiwihangintinungoalbularyosellnakatunghayanakbinilhankonsultasyonnasasalinansuzetteflexibleanibersaryodaladalamakakaonlylunesmetoderseeknakatalungkomagsubocandidatesupportpagkalungkotnanlilisikmahinogbumagsakunidosnalugodmaglinisdatingpisarakuwentomatabanggago-ordernangingiliddinalacompositoresmansanaspusangdollarkinakainumiyakmagalangkagandahagisdanagsisigawmaisnangkalaunandisenyongtumagaltipidkinikilalangnapiliinternalika-50matangkadstore1982bagyokapitbahaypaanonagtatakboinaabotpagkakalutodahan-dahanpresidentelumilipadngitilabasmadamipaumanhinpamilyangnilaoslittlesumisidmatarayrosaspakakasalanpangetaraylookedboracaykaringpagtatanongstaymabilisstyreselebrasyonnakainomnakapagproposedoktorapelyidomamayamilyongawatumamisbangproperlyarawnagagamitmakapangyarihanpapelnakikini-kinitaumigtadmagpapabunotmedisinakolehiyomanonoodartsrollkalakimamahalinunconstitutionalisinalangkuwadernoumuwimoneypagbabagokontingcultivarnakatagoentrancebingbingpagmamanehokalalarotumunogcardigantarcilaibinalitangdescargarrabbaplagasmagnifyarkilainfluenceshdtvpakikipagtagpo00amnagyayangcruzmasasalubongjuegoskatolikohumigabopolsumigibshadessanapalantandaanbawatcitykakayanandalawintatlolegitimate,asawa