Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

18 sentences found for "content,"

1. Creating and monetizing content: You can make money online by creating content, such as videos, podcasts, or blog posts, and monetizing it through advertising, sponsorships, or merchandise sales

2. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

3. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

4. Instagram has become a platform for influencers and content creators to share their work and build a following.

5. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

6. Smoking can be addictive due to the nicotine content in tobacco products.

7. The character in the movie was content in his simple life, believing that ignorance is bliss.

8. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

9. The Explore page on Instagram showcases content from various categories such as fashion, food, travel, and more, catering to different interests and preferences.

10. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

11. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

12. The platform has also been criticized for promoting harmful content and contributing to online bullying.

13. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

14. The TikTok generation is reshaping the way we consume and create content, with short-form videos becoming the new norm.

15. The website's content is engaging and informative, making it a great resource for users.

16. The website's social media buttons make it easy for users to share content on their social networks.

17. TikTok has become a popular platform for influencers and content creators to build their audience.

18. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

Random Sentences

1. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

2. Tatanghaliin na naman bago siya makasahod.

3. Don't spill the beans about the project, it's supposed to be a secret.

4. The professional athlete signed a hefty contract with the team.

5.

6. Itinuring nila itong kapamilya at nakatulong pa kay Roque sa pang-araw-araw na pahahanap ng pagkain.

7. Tinikman nila ang hinog na bunga at natuwa sa tamis at sarap nito.

8. Monas di Jakarta adalah landmark terkenal Indonesia yang menjadi ikon kota Jakarta.

9. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

10. Sa buwan ng Mayo ang kaarawan ko.

11. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

12. El aloe vera es una hierba medicinal conocida por sus propiedades curativas para la piel.

13. Sa ganang iyo, mahalaga ba talaga ang pagkakaroon ng mataas na grado sa eskwelahan?

14. I absolutely love spending time with my family.

15. Some people choose to limit their consumption of sweet foods and drinks for health reasons.

16. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

17. Nalalaglag na ang nagsasanggang kamay.

18. Sate adalah makanan yang terdiri dari potongan daging yang ditusuk pada bambu dan dibakar dengan bumbu kacang.

19. Ito ay pinangalanang Hari ng Karagatan na walang takot kaninuman.

20. Ayos lang. Basta alam kong safe kang nakauwi.

21. Emphasis is an important tool in public speaking and effective communication.

22. Omelettes are a popular choice for those following a low-carb or high-protein diet.

23. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

24. Baby fever can affect people of various ages, backgrounds, and genders.

25. La música clásica tiene una belleza sublime que trasciende el tiempo.

26. Ang pagtulong sa iba o pagbibigay ng serbisyo ay isang nakagagamot na karanasan na nagbibigay ng tunay na kaligayahan.

27. La tos aguda dura menos de tres semanas y generalmente se debe a una infección viral.

28. Celles-ci comprennent la thérapie, le conseil et les groupes de soutien.

29. Ano ang gustong palitan ng Monsignor?

30. Sa takip-silim, mas mahimbing ang tulog dahil sa kalmado at malamig na panahon.

31. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

32. Bukas ay magpapagupit na ako ng buhok.

33. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

34. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

35. Hindi pa nga ako nagtatanghalian eh.

36. Siya nama'y maglalabing-anim na.

37. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

38. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

39. How I wonder what you are.

40. The market is currently facing economic uncertainty due to the pandemic.

41. Mababaw ang swimming pool sa hotel.

42. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

43. Ano ang paborito mong pagkain?

44. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

45. The patient was referred to a specialist in leukemia treatment for further evaluation and care.

46. May masakit ba sayo?? Ok ka lang ba?

47. Ang sugal ay maaaring magdulot ng pagkakaroon ng mga utang at pinansyal na problema.

48. Ang kabayanihan ni Rizal ay patuloy na pinararangalan sa pamamagitan ng pagdiriwang ng kanyang kaarawan at mga aktibidad sa buong bansa.

49. Napakalamig sa Tagaytay.

50. The desire for a baby can be accompanied by feelings of emptiness, longing, and a sense of incompleteness.

Recent Searches

content,surgerysementongsementonapakamotcalambainternalnag-iyakaninternacionalniligawaninasikasonakilalabumilishappierparusahanhulubingbingnanlalamiginternangunitnapakamisteryosomulingnatingalapangingimiinferioresmagbalikumalisbairdpowersjunjunsigurosakinbumiliwarimustmajortrycyclesumasayawdaratingsahigipagamotnapakalamigamingbreakomgandreamenosnaglalarobutihingrefnangagsipagkantahanvehiclesmalalakibobomakisigbatok---kaylamigpaki-drawingaudiencepowerbarcelonalikelytinangkamisteryoyatapatakboshinesupuanmag-ibalipadpagelamigiikotmagkabilangulamzoopangarapjuneeffectstevesmalllalakinararanasankasangkapanipagmalaakimabutikumalasnahintakutandenmagkikitagagawingodtentrymakakakaennanunuksosinumankumunotisinulatilalimkasolivesmagsasakainfluencesmagdilimrangesourcefertilizerconclusion,masasalubongkailanmannagtatanongmeansexhaustionbabetaksihinihintaynaminkulangpagkaawaagostomatitigasbilinbihasatopicyorknagtitindaigigiitstaypakibigaytradeililibrebahagiworkshoptandangsinaliksikkayobagkus,popcornitakilingincreasesklasrumrelyincluirmagpagalingdigitalbringlargermatayognahantadandylagnateditorstatuskinuhaginagawasolidifynagdaosautomationprogramming,inaapi11pmdesarrollaredit:aidnag-aaralnagpipiknikmapskillsmanakbopangkatpresentnapapadaancallobservation,taga-ochandobabesfederalismalikabukinpinasalamatanpakukuluankasalukuyankumananikinagagalakgasmenenglandpresidentialtenidoinuulamamparokaloobangusaentrancegayunmanmaputibisikletatilibinilinapakatalinotrentamagkasama