Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "speed"

1. Basketball requires a combination of physical and mental skills, including coordination, agility, speed, and strategic thinking.

2. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

3. Hockey requires a combination of physical and mental skills, including speed, agility, strength, and strategic thinking.

4. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

5. Musk has also been involved in developing high-speed transportation systems such as the Hyperloop.

6. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

7. The Flash can move at superhuman speed, making him the fastest man alive.

8. The website's loading speed is fast, which improves user experience and reduces bounce rates.

9. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

Random Sentences

1. Nagpunta si Emilio Aguinaldo sa Hong Kong pagkatapos ng Biak-na-Bato.

2. El nacimiento es el comienzo de una vida llena de aprendizaje, crecimiento y amor.

3. Ang tubig-ulan ay nakakatulong sa pagpapanatili ng balanse ng mga ekosistema.

4. Después del nacimiento, el bebé puede ser amamantado o alimentado con fórmula, dependiendo de las preferencias de los padres y la salud del bebé.

5. Samvittigheden er vores indre stemme, der fortæller os, hvad der er rigtigt og forkert.

6. Nahihirapan ka na siguro.. sorry.

7. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

8. The scientific method is used to test and refine theories through experimentation.

9. At have håb om at gøre en forskel i verden kan føre til store bedrifter.

10. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

11. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

12. The concept of money has been around for thousands of years and has evolved over time.

13. Puwedeng hiramin mo ang aking laptop habang inaayos ang iyong sarili?

14. Are you crazy?! Bakit mo ginawa yun?!

15. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

16. Not only that; but as the population of the world increases, the need for energy will also increase

17. Budgeting, saving, and investing are important aspects of money management.

18. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

19. Ibinigay ko ang lahat ng aking lakas at determinasyon upang makamit ang aking mga layunin.

20. Gusto ko lang ng kaunting pagkain.

21. Sa Sabado ng hapon ang pulong.

22. Boboto ka ba sa darating na eleksyon?

23. Sa dakong huli, nakita ko ang aking kaibigan na umiiyak sa sulok ng classroom.

24. Bitcoin is the first and most well-known cryptocurrency.

25. "Mahalaga ang kalusugan, kaya alagaan natin ang ating katawan," ani ng doktor.

26. Tumawag ang pamilya ng albularyo upang gumaling ang kanilang kamag-anak mula sa misteryosong sakit.

27. Håbet om en bedre fremtid kan give os motivation til at arbejde hårdt.

28. Stocks and bonds are generally more liquid than real estate or other alternative investments.

29. B-bakit mo pinatay yung ilaw?! biglang tanong ni Cross.

30. Después de hacer ejercicio, me gusta darme una ducha caliente.

31. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

32. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

33. He applied for a credit card to build his credit history.

34. El teatro experimental presenta una interpretación sublime del teatro moderno.

35. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

36. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

37. The children play in the playground.

38. Paano ho ako pupunta sa Palma Hall?

39. Ang maaamong hayop ay nagiging mailap dahil sa pananakit ni Kiko.

40. Rektanggulo ang hugis ng mesa namin.

41. He is typing on his computer.

42. Nationalism can be a source of inspiration for artists, writers, and musicians.

43. Bigla niyang naalala si Helena, napatigil siya sa kanyang pag-iyak at napangiti na lang ang binata.

44. Binili ko ang bulaklak para kay Ida.

45. Limitations can be financial, such as a lack of resources to pursue education or travel.

46. La boda de mi amigo fue una celebración inolvidable.

47. Limiting the consumption of processed foods and added sugars can improve overall health.

48. Isasama ko ang aking mga kapatid sa pamanhikan.

49. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

50. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

Recent Searches

halamanspeedilanposterwhetherandrepackagingincreaseeffectsgenerationsbeyondbroadcastsalignsscalemakesstoplightblessnahantadyataabigaelngunitbitiwanmakalabaspagbabagong-anyoauditnakamalikotcebupaglisankaramdamanwednesdaytravelparusahancaracterizakaparehanapakagalingsagabaltanghaliankinauupuaniwanpeperosaspananakithikingphilosophicalvedvarendeuugod-ugodfilmisuotokaykayopaglalayagmagpa-picturemeantiniradortiyakiyoparaplagueddalandanpiyanocreatingailmentsawanakabulagtangpagbatinagbabasamamitaspaksamamanhikannakakapuntabarrocosidoinspirationumigibpagbabayadkungsupremebroughtpayenternutrientesconsiderarpamburaanibersaryomerlindakumitapagkakalutokalakihannangagsipagkantahanmagta-trabahomakakatakasbangladeshmayamayamagagawagirlatensyongkubyertosnapagtantoglobalisasyonerlindakarunungannakapaligidtinangkapagkamanghasikre,magkaparehokuripotopisinanakilalapatakbomamahalintemperaturasistemaslondonpanindananunuksotatanggapinumiyaksabihinmalapalasyosinasabipinapataposnalakimagpagupittangeksnaglokoinabutanlumayona-fundpaglapastangannapakahabakakatapospioneertumingalanewsginawangtulisannakaakyatpropesornasilawpinangalanannasaangcultivationregulering,companiestumatawadkaliwadisensyoginoongtaksipaakyatnagniningningendvideremarangaliwananpinaulanannatatanawbanalbilihinniyogkabighapitongengkantadapangakorecibircoughingcandidateskatolikocashnangingilidandreadyosaantesaustralianuevomatulunginmatitigassandaliarkilaindividualsnenabinatilyo1960spamamahingaatensyonlaranganpa-dayagonalinventionkumustamaubosnaglabananmaidaksidenteparinibinalitanglandgodthomeskarapatan