Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "anywhere"

1. Automation and robotics have replaced many manual labor jobs, while the internet and digital tools have made it possible for people to work from anywhere

2. If you keep beating around the bush, we'll never get anywhere.

3. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

4. Mobile phones, also known as cell phones, are portable devices that allow people to make and receive calls anywhere they have a wireless connection

5. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

6. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

Random Sentences

1. La música también es una parte importante de la educación en España

2. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

3. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

4. Pumupunta ako sa Laguna tuwing Mayo.

5. Ano ang dapat gawin ng pamahalaan?

6. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

7. Sa bawat panaghoy ng mga ina, umaasa silang magkakaroon ng katarungan ang kanilang mga anak.

8. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

9. He has been practicing yoga for years.

10. El maíz necesita sol y un suelo rico en nutrientes

11. Madulas ang magnanakaw, ngunit nahuli rin siya ng mga naglalakad na sibilyan.

12. Bestfriend! impit na tili ni Mica habang palapit sa akin.

13. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

14. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

15. Nag-uumigting ang kanyang mga ugat

16. Many people think they can write a book, but good writers are not a dime a dozen.

17. La perspectiva es una técnica importante para crear la ilusión de profundidad en la pintura.

18. Bago matulog, naglalaba ako ng aking uniporme para sa darating na school week.

19. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

20. Ha? Ano yung last na sinabi mo? May binulong ka eh.

21. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

22. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

23. Les thérapies alternatives telles que l'acupuncture et la méditation peuvent aider à réduire le stress et améliorer la santé mentale.

24. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

25. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

26. The presentation was absolutely flawless; you did a great job.

27. She burned bridges with her friends by spreading gossip about them.

28. Les personnes âgées peuvent avoir des relations affectives et intimes avec leur partenaire.

29. Maraming hindi sumunod sa health protocols, samakatuwid, mabilis kumalat ang sakit.

30. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

31. Users can like, comment, and share posts on Instagram, fostering engagement and interaction.

32. Talaga? Sige nga ipakita mo nga saken.

33. Hindi kita puwedeng iwan dahil mahal kita.

34. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

35. Mabilis na lumipad ang paniki palabas ng kweba.

36. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

37. Siguro nga isa lang akong rebound.

38. Hinde na ko nag dalawang isip pang lapitan sila.

39. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

40. Me gusta comprar chocolates en forma de corazón para mi novio en el Día de San Valentín.

41. Napakalaki talaga ng isla sa boracay.

42. Hindi ko maipaliwanag kung gaano kalalim ang inis ko sa mga taong nagtatapang-tapangan lang.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

45. Hinatid ako ng taksi sa bahay ni Mrs. Lee.

46. Sa mga sitwasyon ng buhay, ang mailap na oportunidad ay kailangan mabilis na kinukuha.

47. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

48. Ahh.. sinuot na niya to tapos nag patuyo ng buhok.

49. Hindi ko masikmura ang pumatol sa walang kalaban laban.

50. I finally finished my degree at age 40 - better late than never!

Recent Searches

anywheremaulitcassandraarguetumangomininimizesupilinbinatanglaranganmagworkpalagiasokasingtigasmangingisdaiiklicasaskype1940itinagokwebabarrocovehiclesalexanderredigeringbabessakinorugaumingitkerbfuelburgersumabognilinisharingproperlyearnmightcongressdibabroadcastingseparationoutlinesnilutodamithapdioneilawdumalawbihiragatoleroplanotalagangexigentecantidadnatatanawakmangmabangisnauntogparusahanhinalungkatpasahebahagyapinabulaangubatmagkabilangvaliosamagbabalapagdiriwangnakauslingmagselosdepartmentkasiyahangsinunud-ssunodkinatatalungkuangginugunitadistansyanakipagtagisannagagandahanikinabubuhaynamumulaklaknakaupodiwatanagbanggaannagtutulungankasalukuyanmakalaglag-pantypagkakapagsalitaoktubrepamamasyalclubkatawangpagsumamotumahimiknag-iinomnapaluhanagwelgapapagalitanikinamataykagandahaghinagud-hagodressourcernemalezatinatawagsong-writingpagpapakilalanagbakasyonpare-parehoadvertising,lumalangoynagdadasaltinanggapdeliciosamakakakaenkabuntisanpahahanapmanghikayatrebolusyonuugud-ugodnakaraankumaliwanagnakawpinagkiskismaliksipronounkinabubuhaypinakamahabamatapobrengunti-untimiranapaiyakmaglalaroaanhinnag-aaralinvestnaapektuhanmagdoorbellmaliwanagnaliwanaganpresidentekinasisindakantanggalinkusinerotatagalmahahaliknapagtantopinasalamatanpaki-chargedaramdaminculturetinutoppinagbigyankalaunanatensyongnagdiretsoconectadosguronaglokohaninagawpanindapagkaawapagkagisinglumabasnaghihirapjuegosnapakagandanapasubsobkinalilibingannagsmilewatawatmagbibigaytv-showsmedicalmagbantaylandlinenagwagitinakasanarbejdsstyrkepahiramnglalababinuksanpapuntangtinuturonatanongsinehanbayadkasamaanglumipadmagawaisinusuotregulering,pundidokumanannakaakyatlumagokadalaspaninigastumamapumulotisinaboyindependently