Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "teach"

1. "Dogs come into our lives to teach us about love and loyalty."

2. "You can't teach an old dog new tricks."

3. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

Random Sentences

1. Ang mga miyembro ng komunidad ay hinikayat na magbigay ng kanilang mga mungkahi upang mapabuti ang mga serbisyo ng pamahalaan.

2. Naramdaman kong nag vibrate yung phone ko.

3. She has just left the office.

4. Ang pangamba ay hindi dapat iwasan, sa halip ay dapat itong harapin upang maiwasan ang mas malaking panganib.

5. He has been practicing basketball for hours.

6. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

7. El powerbank utiliza una batería recargable para almacenar energía.

8. Nasaktan siya nang salatin ang mainit na kawali.

9. Si John ay isang mabuting kaibigan, datapwat minsan ay napag-uusapan namin ang mga hindi magandang bagay.

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Nicole Kidman is an Academy Award-winning actress known for her performances in movies such as "Moulin Rouge!" and "The Hours."

12. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

13. Hun er min store forelskelse. (She's my big crush.)

14. Omelettes are quick and easy to prepare, making them a convenient meal option.

15. Ang mga magsasaka ay nagtatanim ng palay.

16. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

17. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

18. It was founded by Jeff Bezos in 1994.

19. Promote your book: Once your book is published, it's important to promote it to potential readers

20. Las personas pobres merecen ser tratadas con respeto y compasión, no con desdén o indiferencia.

21. Makikiligo siya sa shower room ng gym.

22. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

23. My co-workers organized a surprise birthday party for me at the office.

24. May mga turista na nagpasyang lumibot sa pamamagitan ng bisikleta para mas mapadali ang kanilang paglalakbay.

25. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

26. Ang pagtatayo o pagsali sa isang komunidad o samahan ay nakagagamot sa aking pakiramdam ng pagka-bahagi at pagkakakilanlan.

27. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

28. Sa wakas, nangahas siyang sundin ang kanyang pangarap, anuman ang mga balakid na nasa kanyang harapan.

29. Ang aming angkan ay nagpapahalaga sa tradisyong pamilya.

30. Una buena conciencia nos da una sensación de paz y satisfacción.

31. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

32. Tesla's Gigafactories, such as the Gigafactory in Nevada, are massive production facilities dedicated to manufacturing electric vehicle components and batteries.

33. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

34. "Walang imposible basta may tiyaga," ani ng isang matagumpay na negosyante.

35. Pinagtabuyan ng mga mababangis na hayop at ng mga ibon ang kawawang si Paniki.

36. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

37. The Tesla Model S was the first electric car to have a range of over 300 miles on a single charge.

38. Lagi na siyang tulala, hindi na siya halos nakakapasok sa paaralan at lagi lang siyang nasa simbaha't nagdarasal.

39. It's important to be realistic about your expectations and to choose a strategy that aligns with your skills and interests

40. Dahan-dahan niyang iniangat iyon.

41. They are cleaning their house.

42. But as in all things, too much televiewing may prove harmful. In many cases, the habit of watching TV has an adverse effect on the study habits of the young.

43. Viruses can be used as vectors to deliver genetic material into cells, which can be used to treat genetic disorders.

44. Foreclosed properties can be a good option for those who are willing to put in the time and effort to find the right property.

45. Kapag nagkakasama-sama ang pamilya, malakas ang kapangyarihan.

46. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

47. Eating fresh, unprocessed foods can help reduce the risk of heart disease and diabetes.

48. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

49. "Dog is man's best friend."

50. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

Similar Words

teacherteachings

Recent Searches

teachkumaripasmapaikotdamitpulaheykabilangbalderesourcesovertargetredetodaysagingmapadalieyemabutingcommunicationmapbituincontrolainterviewingeffectcountlessinteligentespuntanotebookhapasinbeyondbringinghimiglabinglikodginoosampunghinamonnagtungopaghalakhakluluwasbiologisolarmakapalagmangiyak-ngiyakbaosilid-aralannapakalusogkangitangamebahagyangbulalasibigpromisemalasutlagrewcelularesinnovationkulisappangitinterestscalidadtinderadiagnoseshinagpissapagkatmakaratinginamalalimmansanaschavitlimosngunitdinalawgearpalasyobinentahankuwentoconsiderdevicesutilizanpinakamaartengsundhedspleje,gayundingratificante,videos,kinikitapagpasensyahankasaganaannakaka-innaglalakadnagtitindaatinkapangyarihangnakapagsabisasayawintumahimikkuwartofollowing,napakagagandanaibibigaydoble-karamagkaibangkumidlatcrucialkinakabahanisasabadmagdamaganpamasahepinapalonaiilagankalakinapapahintomabatongumiimikdesisyonanmakawalakanginajingjingemocioneslibertytsismosanatinagisasamadireksyonpwedengmahahalikgumuhittuktokkaliwaeksempeltelebisyonfactoresnatuwakundimanchristmasendvidereitinaobtiemposbayaniinspirationadmiredlupainbayaningdiliginvariedadsinisikakayananlakadengkantadaisubobinawianhanapinginactricaslangkaydiapermaalwangtibokandoykutsilyoasiatulalasinungalingyoutubematayogbooksmaisipsalesnag-pilotokatagalanplagaskasaysayanyeynanayteachernatulogpagtutoljocelynlinawnagpuntaaffiliatepataykarangalanpapelalaaladaladaladinanasresumennicoskypeiniinomtuladamerika11pmsilbingproductionfurjoeisugaboss