Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "mag bubuklod"

1. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

2. Ako ay sobrang gutom, bagkus ako ay mag-aantay na lang ng hapunan mamaya.

3. Ang abilidad na mag-isip nang malikhain ay nagbibigay daan sa paglutas ng mga problema.

4. Ang bawat paaralan ay nag-aapuhap ng mga donasyon para sa bagong aklat at kagamitan ng kanilang mga mag-aaral.

5. Ang galing nyang mag bake ng cake!

6. Ang haba na nang bigote mo, mag ahit ka nga!

7. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

8. Ang kelangan mo na lang gawin ay mag dasal..

9. Ang mag-aaral ay nagsusulat ng mga sanaysay at mga ulat bilang bahagi ng kanilang mga proyekto.

10. Ang mag-asawa ay may hanapbuhay na paghahabi ng mga tela.

11. Ang mahiwagang pagsagot ng prinsipeng tila ba mag agam-agam.

12. Ang mga dentista ay maaaring mag-rekomenda ng mga produkto na dapat gamitin upang mapanatili ang malusog na ngipin.

13. Ang mga engineer nagsisilbi upang mag-disenyo at magtayo ng mga imprastraktura para sa publiko.

14. Ang mga guro ay humingi ng mga mungkahi mula sa kanilang mga mag-aaral upang mapabuti ang kanilang pagtuturo.

15. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

16. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

17. Ang mga paaralan ay maaaring magpakalat ng kamalayan sa mga mag-aaral tungkol sa panganib ng paggamit ng droga.

18. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakasaya at mag-enjoy sa buhay.

19. Ang pagguhit ay isang paraan upang mag-relax at magpakalma.

20. Ang pagkakaroon ng maayos na usapan ay nagpawi ng mga alinlangan sa pagitan naming mag-asawa.

21. Ang pagtawanan at mag-enjoy kasama ang mga kaibigan ay isang nakagagamot na aktibidad.

22. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

23. Ang takip-silim ay isang magandang panahon para mag-unwind at mag-isip-isip sa mga bagay-bagay.

24. Ate, gusto ko sanang mag-isa.. ok lang ba?

25. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

26. Bawal mag-abuso ng kapangyarihan dahil ito ay isang krimen.

27. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

28. Bawal mag-ingay sa loob ng liblib na lugar dahil ito ay nakakabulahaw sa mga hayop.

29. Bawal mag-smoke sa loob ng opisina dahil sa panganib na dulot ng usok sa kalusugan ng ibang tao.

30. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

31. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

32. Busog pa ako, kakatapos ko lang mag merienda.

33. Bye! liliko na sana ako para mag-iba ng exit.

34. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

35. Dapat tayong mag-ingat sa sobrang pangamba dahil ito ay maaaring makaapekto sa ating kalusugan.

36. Doon nila ipinasyang mag honeymoon.

37. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

38. Gusto ko na mag swimming!

39. Gusto ko pang mag-order ng kanin.

40. Gusto kong mag-order ng pagkain.

41. Habang maliit pa ang bata ay itinuro na ng mag-asawa kung paano ang humabi.

42. Halos dalawang linggong nag quarantine ang pamilya ni Josie matapos mag positibo sa covid.

43. Halos nakalimutan na ng mag-asawa ang nangyari sa diwata.

44. Hindi ko alam kung saan ito mag-uumpisa, pero may gusto ako sa iyo.

45. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

46. Hindi lahat ng tao ay bukas palad, kaya kailangan mong mag-ingat sa mga taong pwede kang masaktan.

47. Hindi mo na kailangan mag-isa dahil ako ang iyong kaulayaw.

48. Hindi naman natuwa ang mga estudyante sa pagkakaroon ng reshuffling dahil kailangan nilang lumipat ng silid-aralan at mag-adjust ulit sa kanilang mga kaklase.

49. Hindi niya inaasahan na mag-iwan ng malaking marka sa kanyang komunidad ang kanyang paglilingkod.

50. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

51. Hinugot niya ang kanyang cellphone upang mag-reply sa aking mensahe.

52. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

53. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

54. Inalagaan ng mag-asawa ang halaman at nang lumaki ay nagkabunga.

55. Inisip ko na lang na hindi sila worth it para hindi ako mag-inis.

56. Isang araw, kararating pa lang ng mag-asawa mula sa pagtitinda ng gulay, galing sa kuwarto ay lumabas si Aya at hiningi ang ipinagbiling prutas.

57. Kahit hindi ka magaling sa pagguhit, puwede ka pa ring matuto at mag-improve sa pagguhit.

58. Kailangan mong mag-isip nang malalim upang makita mo ang kaibuturan ng kanyang problema.

59. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

60. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

61. Kapag dapit-hapon, masarap mag-jogging dahil mas malamig na ang panahon.

62. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

63. Kapag mayroon kang kaulayaw, hindi ka mag-iisa sa mga pagsubok na iyong kinakaharap.

64. Kapag nasa agaw-buhay na sitwasyon, kailangan nating mag-ingat at magtulungan para sa ating kaligtasan.

65. Labis na ikinatuwa ng mag-asawa ang biyayang ito,pangalanan nila ang bata na Rabona, pinaghalo ang pangalan ni Rodona at ang bundok ng Rabba.

66. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

67. Mag asawa na kayo pero hindi mo pa nasasabing mahal mo siya?

68. Mag de-dekorasyon kami mamaya para sa kanyang 18th birthday.

69. Mag o-online ako mamayang gabi.

70. Mag-aaral ako ngayon, datapwat sa hapon ay pupunta ako sa doktor.

71. Mag-aaral ako sa unibersidad sa susunod na taon.

72. Mag-babait na po siya.

73. Mag-iikasiyam na nang dumating siya sa pamilihan.

74. Mag-ingat sa aso.

75. Mag-usap tayo sa WhatsApp o Line.

76. Mag-uusap kami sa makalawa ng tanghali.

77. Magandang ideya ang magbakasyon, datapwat kailangan ko munang mag-ipon.

78. Mahalagang mag-ingat sa ating kalusugan, datapapwat ay hindi natin nakikita ang mga mikrobyo at virus na nagdadala ng sakit.

79. Mahusay mag drawing si John.

80. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

81. Marahil ay hindi magandang ideya na maglakad mag-isa sa madaling araw.

82. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

83. Masakit man aminin, hindi maiiwasan na mag-inis tayo sa mga taong nakapaligid sa atin.

84. Masarap mag-surfing sa dapit-hapon dahil mas malamig na ang dagat.

85. Matapos ang matagal na relasyon, napagpasyahan niyang mag-iwan at mag-move on.

86. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

87. Nagdesisyon siyang mag-iwan ng trabaho upang magtayo ng sariling negosyo.

88. Naging mayaman din ang mag-anak dahil sa mga bentang tela na ginagawa ng bata.

89. Nagitla ako nang biglang mag-ding ang doorbell nang walang inaasahan.

90. Nagkatinginan ang mag-ama.

91. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

92. Nagsisimula akong mag-exercise sa hatinggabi para sa aking kalusugan.

93. Nagsusulat ako ng mga liham ng aplikasyon upang mag-apply sa trabaho o scholarship.

94. Nais niyang mag-iwan ng sulat para sa kanyang mahal.

95. Naisip niyang mag-iwan ng masamang karanasan sa likod at simulan ang panibagong buhay.

96. Nakakatakot maglakad mag-isa sa hatinggabi sa isang hindi kilalang lugar.

97. Nakasabit ang mga larawan ng mga nangungunang mag-aaral sa silid-aralan upang bigyan ng inspirasyon ang mga bata.

98. Nang mag-asawa ang mga kapatid ni Psyche, humingi siya ng payo kay Apollo kung sino ang dapat mapangasawa niya.

99. Nang magkaharap ang mag-ama, ang kanyang ama ay hindi niya ito tinanggap

100. Nanggaling ako sa isang malakas na liwanag papunta sa pagdidilim ng gabi, kaya't nahirapan akong mag-adjust sa aking paningin.

Random Sentences

1. The baby is sleeping in the crib.

2. Mahal na mahal ni Aling Rosa ang kanyang bugtong na anak.

3. Tulala lang rin yung daddy niya sa amin.

4. A lot of traffic on the highway delayed our trip.

5. Nogle helte er kendte for deres modige handlinger under krig.

6. Beast. sabi ko pagkalapit sa kanya.

7. Ano ba pinagsasabi mo?

8. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

9. Ang pambansang bayani ng Pilipinas ay si Jose Rizal.

10. Les prêts sont une forme courante de financement pour les projets importants.

11. Sigurado ka? Hala! Mag-order ka rin ng burger at fries!

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Nasawi ang drayber ng isang kotse.

14. Natawa na lang ako sa magkapatid.

15. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

16. Sana po ay maibalik ko pa ang panahon upang mabigyan sila ng kasiyahan.

17. The wedding ceremony is often followed by a honeymoon.

18. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

19. Ang mga punong-kahoy ay kadalasang tinatanim bilang mga pampaganda sa mga pampublikong lugar tulad ng parke o plaza.

20. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

21. It has been found that by abstaining from smoking a person may be cured of many diseases

22. If you keep cutting corners, the quality of your work will suffer.

23. Maarte siya sa kanyang pagpili ng libro kaya halos lahat ng kanyang binabasa ay mga klasikong nobela.

24. La realidad puede ser cambiante, debemos ser flexibles y adaptarnos.

25. Panalangin ko sa habang buhay.

26. Dahil dito ang mga tao ay laging may mga piging.

27. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

28. Nangumbida ako ng maraming tao kasabay ng biling 'wag kalimutan ang regalo at pagbati ng �Happy Birthday,Rebo!�

29. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

30. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

31. I'm nervous for my audition tomorrow, but I'll just have to go out there and break a leg.

32. Naiinitan talaga ako, malamig ba labi mo?

33. Hindi ko kaya itago ang aking damdamin, kaya sana pwede ba kita ligawan?

34. El sismo produjo una gran destrucción en la ciudad y causó muchas muertes.

35. Anong award ang pinanalunan ni Peter?

36. Wala akong pakelam! Dapat sayo pinapalo!

37. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

38. My grandfather used to tell me to "break a leg" before every soccer game I played.

39. Hindi maganda na palaging may agam-agam sa buhay, dahil ito ay maaaring magdulot ng stress at anxiety.

40. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

41. Ang mabuting kaibigan, ay higit pa sa kayamanan.

42. Las hojas de mi planta de tomate se ven amarillentas y enfermas.

43. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

44. Ang ganda naman nya, sana-all!

45. Twitter is also used by businesses and brands for marketing, customer engagement, and brand promotion.

46. Gaano katagal po ba papuntang palengke?

47. May mga espesyal na pagdiriwang tuwing Linggo sa aming komunidad malapit sa karagatan.

48. Bigla siyang bumaligtad.

49. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

50. Einstein's most famous equation, E=mc², describes the relationship between energy and mass.

Recent Searches

ginagawafatalumagatsinaitinatagfilipinabitaminakinakainpinalutopinabiligloriapangungusappinagawakinaininalokkaninangsinabipinakainbinabatilondonminahantinapayginamithinatidkaninaitinaponitinagokinagatkinantakinausapkinayajuicemakinangrinikinabitilalagaykayangnakakasamamakapagsabimakakayakakayanankakayanangkayabanganmanghikayatkayang-kayangkayaarbejderkinabibilangankinabubuhaykinakitaankinasisindakankinalakihanpakinabanganguiltykinagalitankinakaligligkinauupuankinalimutankinalilibingankinakabahanikinatuwakinaumagahankinakailangangkinamumuhiannahahalinhankinatitirikanikinakatwirankinatatakutankinakailangankinahuhumalingankinapinataypinansinpinapalopinag-aralanpinaghalopinagpalaluanpinagkakaguluhanpinagnagtatrabahopinatidpinangaralanresourcespinangpinatirapinasokipinakoipinatawmahinognapalingonhinoggaanopotentialipinadakipipinaalamipinamiliipinansasahogipinagbabawalipinaipinalitpinauwistoplightpinangalananipinagbilingpinagwikaanipinahamakpinagalitanipinagdiriwangipinatutupadipinakitaipinagbibiliipinauutangpinagtulakanpinalakingpinagsulatpinaulananpinakawalanpinamalagipinalayaspinalalayasunibersidadpinapakiramdamanpinagpapaalalahananpinakamatunogpinagmamasdanpinagwagihangpinatutunayanpinagmamalakipinangaralangpinaglagablabpinabulaanangpinagkaloobanpinangalanangpinapinanoodlinawgasolinagasolinahannatatanginglinatinaytindiginalisintindihinhinampasnakikitangmainstreamsinabinginaabotisinagotsinagotmahinangisinarainabotsinasabibinabaanbinabalikbinabatinaasanitinaastahananyumaonapatulalatumayoumayosmayorhumayolumayomayotinaasbinasabalinganikinagagalakpilipinaspinakamahabapinanalunanipinanganakpinapanoodpinapakingganpinag-aaralaneducationpinaggagagawapinangyarihanpinagbubuksanpinagsanglaanpinagsasasabipinakamalapitinabinibilikatabingbumalingtabingboyetdumilimlumapadenviargenerabageneratekaklasegenerated