Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "hundred"

1. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

2. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

Random Sentences

1. All these years, I have been chasing my passions and following my heart.

2. There are a lot of books on the shelf that I want to read.

3. Ang hinagpis ng buong bansa ay naging lakas upang magkaisa sa harap ng pagsubok.

4. Format your book: Once your book is finalized, it's time to format it for publication

5. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

6. Kumain ako sa kapeterya kaninang tanghali.

7. Malaya na ang ibon sa hawla.

8. Hinde pa naman huli ang lahat diba?

9. The company decided to avoid the risky venture and focus on safer options.

10. Det er også værd at bemærke, at teknologi har haft en stor indvirkning på vores samfund og kultur

11. Nagkapilat ako dahil malalim ang sugat ko.

12. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

13. La conciencia nos ayuda a ser responsables de nuestras acciones y decisiones.

14. He has been to Paris three times.

15. Ang bobo naman ito, di pa nasagutan ang tanong.

16. Ang nagliliyab na araw ay nagdulot ng matinding init sa buong bayan.

17. Ayon sa mga ulat, may paparating umano na bagyo sa susunod na linggo.

18. The momentum of the wave carried the surfer towards the shore.

19. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

20. Omelettes are a popular choice for those following a low-carb or high-protein diet.

21. Congress are elected every two years in a process known as a midterm election

22. Ano ang gusto mong gawin kapag walang pasok?

23. The company's board of directors approved the acquisition of new assets.

24. Opo. Magkapareho po ba ang disenyo?

25. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

26. Siempre hay que tener paciencia con los demás.

27. Ang pagtitiyak ng seguridad sa mga border at mga pantalan ay mahalaga upang maiwasan ang pagpasok ng mga illegal na droga sa bansa.

28. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

29. Es teler adalah minuman dingin yang terdiri dari buah-buahan yang dicampur dengan sirup dan santan.

30. Ang mahal pala ng ticket papuntang Amerika!

31. Dahil dito ang mga tao ay laging may mga piging.

32. Microscopes are also used in materials science and engineering to study the microstructure of materials.

33. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

34. She is not learning a new language currently.

35. At ginawaran ng isang matamis na halik ang labi ng naguguluhang si Mariang Maganda.

36. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

37. Ang agila ang pambansang ibon ng Pilipinas.

38. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

39. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

40. Puwedeng dalhin ng kaibigan ko ang radyo.

41. Magaling maglaro ng chess si Joseph.

42. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

43. The community admires the volunteer efforts of local organizations.

44. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

45. Mula sa kinatatalungkuang giray na batalan, saglit siyang napatigil sa paghuhugas ng mumo sa kamay.

46. Ang galing nya magpaliwanag.

47. Isasama ko ang aking mga kapatid sa pamanhikan.

48. Up above the world so high

49. Bagaimana cara mencari informasi di internet? (How to search for information on the internet?)

50. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

Recent Searches

hundredlimitedgaglandebritishlistahanumalispinatiraelectoralmataaswastojocelynbangkofitsoundxixhitiknunoresumensigadinanasmemberssapagkatmalayangchoosecenterlettereffektivpunsoredigeringkapetransmitspisomakasarilingnamtaposcommunityaccedermukaallowingusamarioaywanmodernepabalikfattanganbugtongbipolarrosenaritopaghugoshalikabilanggoreducedmedievalsoreofficepinalutothereforecountriesiosagilityfansfindbalemalimitgreendetpotentialdividesbadingipapahingakiloteamjoyrolledobstaclesfaultbeautyhimayinmaghanapbighanileadcomplexhulingsalapiwhichreallyipihitstreamingapollomaratingbinentahanfranciscopadalasregularmentesutiltablemabutingpisaranagpaiyakpagpapakalatbarung-barongnationalmagpapagupitkusineromaaksidenteskillsnakabaonmukhabutterfly1960ssandokinatakenuhpriestwaitersilyamarangyangjosebinawigrammarinantokpinggalamang-lupasigawipagbilirhythmleytemadamilaylayspendingpumuntateachespadanangagsipagkantahankalalakihanerhvervslivetbitaminanandiyannapakasipagnakikiakapatawaranpagtutolnakabluepagsahodreadersstruggledmarangalvidtstraktperyahanporpesonangingilidmanonoodrecibirkambingsagotipinangangakpananghalianasawao-orderdumaanpa-dayagonalbundokmaingaynagsulputanlaryngitisnapatinginbevareamoloanskantoclientsomelettesatisfactiondaddyscientifictabing-dagatnapapansintagumpaysulinganreleasedsetsquicklynakakapagpatibayikinatatakotcharitablekatawangmakitamagpapigilmahahawakurakotkamalayansalatinkendikasamasumingitnasuklam