Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "kinalimutan"

1. Ang mga tao ay pumili ng panibagong Sultan at kinalimutan na si Sultan Barabas.

Random Sentences

1. He is not taking a photography class this semester.

2. Alam na niya ang mga iyon.

3. Kapitbahay ni Armael si Juang malilimutin.

4. Puwede ba akong sumakay ng dyipni?

5. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

6. Bitte schön! - You're welcome!

7. Emphasis is often used to highlight important information or ideas.

8. Nakapag-celebrate kami ng aming anniversary ng asawa ko kaya masayang-masaya ako ngayon.

9. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

10. Limitations can be frustrating and may cause feelings of disappointment and failure.

11. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

12. It's time to address the elephant in the room and discuss the difficult decisions that need to be made.

13. Ang bayang magiliw, perlas ng silanganan.

14. Forgiveness is a personal journey that varies for each individual; there is no set timeline or right way to forgive.

15. Gising ka pa?! parang nabigla nyang sabi.

16. Hindi maaring magkaruon ng kapayapaan kung ang marahas na kaguluhan ay patuloy na magaganap.

17. Eating a balanced diet can increase energy levels and improve mood.

18. Claro que sí, estoy dispuesto a aprender cosas nuevas.

19. Bien hecho.

20. Antes de irme, quiero decirte que te cuídes mucho mientras estoy fuera.

21. I have lost my phone again.

22. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

23. Ngayon ang rambutan ay isa sa masasarap na prutas na makikita natin sa ating bansa.

24. Sa ikauunlad ng bayan, disiplina ang kailangan.

25. Las hojas de los cactus son muy resistentes y difíciles de cortar.

26. Viruses are small, infectious agents that can infect cells and cause diseases.

27. Naniniwala ka ba sa legend ng academy?

28. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

29. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

30. Twinkle, twinkle, little star.

31. Nakatingin siya sa labas ng bintana, waring may hinihintay.

32. Hinintay ko siya sa labas ng kanyang opisina upang sabay kaming kumain ng hapunan dahil gustong-gusto ko siyang ligawan.

33. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

34. Hugis katawan ng nakahigang babae ang bundok makiling.

35. Bumibili ako ng pagkain sa grocery store.

36. Ang pagsusuri ng wastong hudyat ay mahalaga sa interaksiyon ng tao at sa pag-unawa ng iba't ibang anyo ng komunikasyon.

37. A dedicated student is willing to put in the extra hours of studying to excel academically.

38. La science des matériaux est utilisée dans la fabrication de nombreux produits de la vie quotidienne.

39. Les travailleurs peuvent obtenir des avantages supplémentaires tels que des bonus ou des primes pour leur excellent travail.

40. Buti naman. Ayoko mahawaan ng kuto eh.

41. Nagreklamo ako tungkol sa pakete ko.

42. Mabuti pang umiwas.

43. Kung anu ano ang kanilang pinag-usapan hanggang sa bigla na lang napabalikwas ang prinsipe na tila ba may tumawag sa kanya.

44. Bibigyan ko ng cake si Roselle.

45. Los invernaderos permiten el cultivo de plantas en condiciones controladas durante todo el año.

46. Ang kaniyang pagsasalaysay ay animo'y isang makulay na kuwento mula sa isang librong mahirap kalimutan.

47. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

48. Ako nga pala si Nicolas, kinagagalak kitang makilala.

49. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

50. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

Recent Searches

kinalimutancoughingpayongmaglabaeleksyonsaronghagdansisidlanphilosophicaliyakbinatilyoanumanricoganunbigongasiaticukol-kayiigibkirotmatigasfe-facebooksalitangmakinangilagaymaibalikinihandabinatakyariadvancecarmenmagigitingwidelybingifauxsamakatwidhinogaudiencelookedhmmmubo00amcitizennasabingheheattractivemournednakasuotisinalangdistancialumusobbangfeedback,kayobrindartuwangasulsaanprinceduonmaestrogreatabundantepersonasbatizoomleytecommissionipagbilisumabogbalingpakelamkamatisinterestyesnagreplymaaringmoodsorebilhinasinayudafiguresbilerhonestoabstainingbaleoutpostoncesuelopookaddislaincreasinglybubongtwinkleitimmapadaliprivatedragonnananaloblessfullbathalacouldbabeorderdanceabsplatformsapelyidoandroidprogramslasingcuandosolidifyuponactivityreadtermdecreasednawalapagpanawbiologimarinigchartshistoriasnayonplanning,tipidagilafloorelepantetumatawadnakakatawapagka-maktolpagpapatubotinulak-tulaknangagsipagkantahanagwadormakapaibabawnalalabikahoynakatirangkinabubuhaykwenta-kwentat-shirtmagpaniwalapinaghihiwanapakatalinonagulatngingisi-ngisingpinakamatabangtinatawagpangungusappinabulaananglumakimedicinenakabawitumatawagnamataypinuntahanhouseholdspinamalagitumagalmiyerkulesnakalockkondisyonmagtagopaglulutoskyldes,lumibotbyggetsistemasbrancher,labinsiyambagkus,kristoperyahanperpektinghahahacountrynapakabilisnakabluenagbentanamumulanagbibirovaccinespagongtuyonilaostamarawkinakainkubyertoslabistagpiangproducerergawaingsinehanmagawanatanggap