Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "idea:"

1. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

2. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

3. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

4. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

5. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

6. Let's just hope na magwork out itong idea ni Memo.

7. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

Random Sentences

1. Una niyang binasa ang batok---kaylamig at kaysarap ng tubig sa kanyang batok.

2. La ingesta adecuada de fibra puede ayudar a regular el sistema digestivo y mantener la salud intestinal.

3. Malungkot ka ba na aalis na ako?

4. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

5. Nalugi ang kanilang negosyo.

6. Para sa kaibigan niyang si Angela

7. All these years, I have been blessed with the love and support of my family and friends.

8. May mahalagang aral o mensahe na ipinakilala sa kabanata, naglalayong magbigay ng kahulugan at kabuluhan sa kwento.

9. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

10. Adik na ako sa larong mobile legends.

11. Despite the many advancements in television technology, there are also concerns about the effects of television on society

12. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

13. My best friend and I share the same birthday.

14. Seguir nuestra conciencia puede requerir coraje y valentía.

15. La música puede ser utilizada para fines políticos o sociales.

16. Get your act together

17. Hormonbehandling og kirurgi kan have forskellige risici og bivirkninger, og det er vigtigt for transkønnede personer at konsultere med kvalificerede sundhedspersonale.

18. Bakit ba? Hinde ba ko pwedeng magsungit?

19. Nag-aaral siya sa library gabi-gabi.

20. Tila asong nagpipilit makapaibabaw si Ogor.

21. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

22. Bakit hindi? ang natigilang pagtatanong ni Mariang Maganda habang pinagmamasdan ang malungkot na mukha ng prinsipeng kanyang iniibig.

23. Bumuhos ang pawis niya sa sobrang gutom at naglalaway na siya.

24. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

25. Accomplishing a long-term goal can create a sense of euphoria and relief.

26. Inflation kann zu einer Abwertung der Währung führen.

27. Einstein was offered the presidency of Israel in 1952, but declined the offer.

28. Es importante ser conscientes de nuestras acciones y cómo pueden afectar a los demás.

29. Nagtataka ako kung bakit hindi mo pa sinasabi sa akin ang totoo.

30. Una de mis pasatiempos más antiguos es coleccionar monedas y billetes de diferentes países.

31. The tree provides shade on a hot day.

32. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

33. Bakit naman kasi ganun ang tanong mo! yan ang nasabi ko.

34. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

35. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

36. Doon nyo sabihin ang gusto nyong sabihin at doon nyo gawin ang gusto nyong gawin

37. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

38. The acquired assets will improve the company's financial performance.

39. They are shopping at the mall.

40. Puwede siyang uminom ng juice.

41. En ren samvittighed kan give os en følelse af ro og tilfredshed.

42. Pumitas siya ng bunga at pinisil ito hanggang sa lumabas ang laman.

43. Will Smith is a versatile actor and rapper known for his roles in films like "Men in Black" and "The Pursuit of Happyness."

44. Taksi ang sasakyan ko papuntang airport.

45. Mathematics can be used to model real-world situations and make predictions.

46. We have visited the museum twice.

47. Utak biya ang tawag sa mahina ang pag iisip

48. Ang Tagaytay ay itinuturing na "Little baguio dahil sa lamig ng klima dito".

49. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

50. Maaga kaming nakarating sa aming pupuntahan.

Recent Searches

idea:callerpuntasapatosdollarbabenaglalabasalapisolidifyshouldmakalaglag-pantyngingisi-ngisingdistansyanakakatulongmorningnapaiyakpinapasayapicturesartistmagtigildali-dalinglagnatisinaboynakapagproposehumahababasahanradiolabasnararapatpakisabinaglabahabitsmagpakaramitandangkastilataksibefolkningenkomedorkakayanangnatitiradreamsindependentlymatitigasmatipunolipadkrusbecomingtonightmaluwangbusiness,resignationblueangjackypedeenforcingshowmagbibigayprogramabituinreallyhighesttaga-nayonspiritualnagpapaniwalakapangyarihannagtatampomagkakagustosatinpaboritomahiwagangpinagawapagsisisisundalokondisyonmiyerkulespawiinpabilipaninigasmaghihintaynakabaonsocietybumagsakmaranasannanigasbaldengbibilicoughingarabiakaniyainiirogmarurusingmaistorbohabitkutodhumpaykakapanooddipangtanodkapainhaybinawiwordmadamiconectadosmalabolinepitakagandastrategypartrestexitclassesskillslavedownpabigatpamamasyalgumagalaw-galawmagsasalitabiocombustiblespagbabagong-anyobangladeshkapasyahantommoneycultivaguitarramagagawanakakatandasiramagagamitlot,kommunikererhinihintaybuwenasnaiiritangnearindustriyainstrumentaladvancementrelosubject,uwaklaamangitinaasganange-commerce,gjortmayabongdetsistersapatsiembrapamimilhingbinanggangayonsigegivepulisniconamuhaywestsantocoinbasecongratsoffentligpublishingsarilingimagingjeepumalisactivitygraduallycomputereaffectpodcasts,pagsasalitakitamakilingpangungutyaanibersaryonapapalibutanespecializadaslabing-siyammahinahinahanapinterests,bilhingustodadalawligaligperomaya-mayagatasmatangkadiniangattinuturopayong