Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nasasabihan"

1. Ganyan talaga ang buhay lagi kang nasasabihan.

Random Sentences

1. Anong ginagawa mo?! mataray pang sabi nito.

2. Madalas na naglulusak sa dumi ang mga bakuran.

3. The rise of digital currencies and payment systems is changing the way people use and think about money.

4. Walang pagtutol sa mga mata ng mga ito.

5. Dedication to environmental conservation involves taking actions to protect and preserve our planet for future generations.

6. El cordón umbilical, que conecta al bebé con la placenta, será cortado después del nacimiento.

7. The pretty lady at the store helped me find the product I was looking for.

8. Maruming babae ang kanyang ina.

9. We should have painted the house last year, but better late than never.

10. They served a mouthwatering strawberry shortcake for dessert.

11. Break a leg

12. Today, Amazon is one of the world's largest online retailers.

13. Los Angeles is home to prestigious universities like UCLA and USC, attracting students from around the world.

14. Biglang nagtinginan sila kay Kenji.

15. Foreclosed properties can be a good option for those who are looking for a fixer-upper project.

16. Magkapareho ang kulay ng mga bag namin.

17. Ayaw niyang kumampi sa matatalo kung kaya't ang ginawa niya ay nagmasid-masid muna ito sa di kalayuan at pinanood ang nagaganap na labanan.

18. He starred in a number of films in the 1950s and 1960s, including Love Me Tender, Jailhouse Rock and Viva Las Vegas

19. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

20. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

21. Ang pagpapahinga ng isip at katawan sa pamamagitan ng meditasyon ay nagdudulot ng isang matiwasay na kalagayan.

22. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

23. The pursuit of money can have both positive and negative effects on people's lives and relationships.

24. Inflation bezieht sich auf die allgemeine Erhöhung der Preise für Waren und Dienstleistungen.

25. Ibinigay ko na ang lahat ng makakaya ko upang matulungan ka.

26. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

27. Jeg kan ikke stoppe med at tænke på ham. Jeg er virkelig forelsket. (I can't stop thinking about him. I'm really in love.)

28. Napatingin yung 7 na babaeng classmate namin na naguusap.

29. Das Gewissen ist unsere innere Stimme, die uns sagt, was richtig und falsch ist.

30. Nakalimutan kong magdala ng lapis sa silid-aralan kaya nagpahiram ako sa aking kaibigan.

31. Nagtatrabaho ako tuwing Martes.

32. Hinahangad ko na makatapos ng yoga session nang hindi naghihingalo.

33. Ibinigay niya ang kanyang talento at galing sa musika upang mapasaya ang marami.

34. The CEO received a hefty bonus for successfully leading the company through a period of growth.

35. I used my credit card to purchase the new laptop.

36. Ano ang binibili ni Consuelo?

37. Jeg kan godt lide at skynde mig om morgenen, så jeg har mere tid til at slappe af senere på dagen. (I like to hurry in the morning, so I have more time to relax later in the day.)

38. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

39. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

40. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

41. We have seen the Grand Canyon.

42. Al usar un powerbank, es importante seguir las instrucciones del fabricante para un uso seguro y adecuado.

43. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

44. I know I should have started studying earlier, but better late than never, right?

45. Dahil sa mabuti niyang pagtuturo, naging interesado ako sa agham at naging guro rin ako.

46. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

47. Ilang tao ang nagsidalo sa graduation mo?

48. Pull yourself together and let's figure out a solution to this problem.

49. Bien hecho.

50. Dalhan ninyo ng prutas si lola.

Recent Searches

nakalocknasasabihangiyeranaguguluhangexhaustiondipangkastilastorpasalamatanuwaktiniklingnagpapaigibnapilitsinelasnagsisigawpasyarabbasumisilipinventionhurtigeremalabocriticspaumanhinasahancafeteriastudentglobaldisappointtatayolinawmagbigayanubolibrostylesbaryorepresentedmagdaraoshatingmandirigmangactivitysalamininaabutanmalltumakassumaliwmakikipagbabagkarnabalhumarapbibisitaklasekingdomdollyganidmatabanapaiyakalbularyonaiinggitbagamatsinimulanendviderecapitalumiinommalayanakapagsabiroonganunnatutuwaparketinanggalsparemerlindatenidokusinaculturessakupinbankkarapatangsubject,landkulturprodujofotosmayabangkalaronakapagreklamotamangmabangistsakamag-asawanggeneratedpusabaku-bakongcongressipinamilituluyanguerreroiskedyulinstitucionescapacidadpinisiledukasyonkonsentrasyonrenaiakulunganestilospioneerswimmingtelebisyonpagkuwabayanimagtatagalkagubatankastilangnaantighagdananinterestslittlenagbanggaanmaskinerlabisaanhindumibaronglolasantosalbaheanihinpagtatakadancejuicedamitespigasnangampanyatinuturospecialipagtimplaregularmanuscriptnahihilomensajesnabalitaantig-bebeintelaruanmagtagoamocaracterizamukapamagatmagtatakatabasmagkahawakgusalinoonnilaosmagpapagupitatebarnuevapalabasmagandangeroplanobulakalak2001pagkaimpaktonai-dialnakakasamainintaystarnakakainkainitanmagsugalplanengkantadaisinumpanuhprincipalessikoputoldyanumiilingevenkunwawalisviewspalapitnananaghilikamatisgigisinghoneymoonmahuhusaypapalapitinantaypiratahumiwaadopteditinagoordermakahingielitefascinating