Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "easy"

1. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

2. Cooking at home with fresh ingredients is an easy way to eat more healthily.

3. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

4. Digital microscopes can capture images and video of small objects, allowing for easy sharing and analysis.

5. Emma Stone won an Academy Award for her role in the film "La La Land" and has appeared in movies like "The Help" and "Easy A."

6. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

7. Omelettes are quick and easy to prepare, making them a convenient meal option.

8. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

9. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

10. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

11. The lightweight design of the tent made it easy to set up and take down during camping trips.

12. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

13. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

14. The website's search function is very effective, making it easy to find the information you need.

15. The website's social media buttons make it easy for users to share content on their social networks.

16. The website's user interface is very user-friendly and easy to navigate.

Random Sentences

1. Umiling siya at umakbay sa akin.

2. Ano-ano pa po ang mga pinaggagagawa ninyo?

3. Les personnes ayant des antécédents de dépendance ou de problèmes de santé mentale peuvent être plus susceptibles de développer une dépendance au jeu.

4. Beauty is in the eye of the beholder.

5. Napatungo ako dahil nangingilid na naman ang mata ko.

6. Ow, sorry nagising ata kita. aniya.

7. The argument was really just a storm in a teacup - it wasn't worth getting upset over.

8. Hindi siya makabangon at makagawa ng gawaing bahay.

9. Pumasok ka na lang sa kwarto. Susunod na lang ako..

10. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

11. Dahan-dahang pumapatak ang gabi at unti-unting nagdidilim ang mga kalye sa paligid.

12. Dedication is the commitment and perseverance towards achieving a goal or purpose.

13. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

14. Kung papansinin mo'y lagi ka ngang mababasag-ulo.

15. Nasa kanluran ang Negros Occidental.

16. Nous avons choisi une chanson spéciale pour notre première danse.

17. Mabilis nyang kinuha ang laptop upang tapusin ang kanyang nobela.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

20. Kapag nagluluto si Nanay, ang buong bahay ay napupuno ng mabangong amoy ng pagkain.

21. Bumalik siya sa bahay nang tulala matapos mawalan ng trabaho.

22. Time heals all wounds.

23. The scientific community is constantly seeking to expand our understanding of the universe.

24. Kailan at saan ipinanganak si Rene?

25.

26. Hay naku, kayo nga ang bahala.

27. Ang empleyado ay na-suway sa pagsusuot ng hindi tamang uniporme sa opisina.

28. Ariana is an advocate for animal rights and follows a vegan lifestyle.

29. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

30. Después de ver la película, fuimos a tomar un café.

31. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

32. Lagi na lang lasing si tatay.

33. Ngunit parang walang puso ang higante.

34. But in most cases, TV watching is a passive thing.

35. Ewan ko sayo, ikaw pinakamaarteng lalakeng nakilala ko.

36. El arte abstracto tiene una simplicidad sublime que pocos pueden entender.

37. Ngumiti siya ng malapad sabay hagikgik.

38. Las rosas rojas son un regalo clásico para el Día de los Enamorados.

39.

40. Sa kasalukuyan, marami ang may agam-agam sa kalagayan ng ating bansa sa gitna ng pandemya.

41. Si Rizal ay nagbigay-inspirasyon sa maraming Pilipino na magkaroon ng katapangan at determinasyon sa kanilang pakikipaglaban para sa pagbabago at katarungan.

42. A couple of students raised their hands to ask questions during the lecture.

43. Lumabas lang saglit si Genna dahil may tumawag sa kanya.

44. Wala nang gatas si Boy.

45. Cancer research and innovation have led to advances in treatment and early detection.

46. Nag-aabang sa langit, sa mga ulap, sumisilip

47. Gusto ko magpahinga sa tahimik na lugar.

48. A quien madruga, Dios le ayuda.

49. Maraming tao sa tabing-dagat sa tag-araw.

50. Not only that; but as the population of the world increases, the need for energy will also increase

Recent Searches

inspiredlikelyeasyauthorputiideakasinggandaputaheshockpinauwigulatmakahiramulingrefboypowersactioncommunicateenvironmentryanplatformnaibabascientistna-curiousguromahiyapumayagslave4thsagotmayomuchsinongahithiramnagpasyaipaliwanagmakakalimutinnagiislowadverselyenchantednalulungkotkinatatakutanmakauuwimagpa-ospitalnagsusulatnapakasinungalingsummerlumiwanagpamamasyalnagpaalamnakalilipasnalalaglagmanlalakbaypinapakiramdamanmagbibiyahenag-poutnagpagupitimpordisenyongnanahimikpamilyangsaritaunti-untimasayahinsesamekatuwaannamataynakatindigpagkasabinagtalagamorningmananakawmangahasactualidadtumakaspaki-ulitmalulungkotkakainintotoongngumiwimakikitulognagwelgapaninigasdyipnipicturesnanonoodhumalopumulotkaklasecorporationnapakabilissarilimangingisdangpagsayadkulturumangatlever,departmentkampeonlugawmaestraipinambilimanakbonatuyosunud-sunodkaraokehistoriacramemagalitnakinigtindigimposiblemagdaraospnilitnahulogtawanankanilacurtainsbiyernespalitangowntilipanatagimbeshabitbuwayapagdamiestateanghelinventadonewspapersnaminjagiyagalingayawenergiaminmagtipidpelikulaexpresandomingosistersinenaghinalasinampalkagandanilulonmakisigcitizenskingdompalangmayabanghuwebesdalangtaposmaskmallrelocontent,sellcongressgreatsubalitbagyoumiinitmatabaluiscafeteriaplayedasinnyekuneconvertidasbentahannahuhumalingnakatitiyakschoolendbabelastinggeneratekarnabalinterpretingbosessensiblepinunitsolidifyerrors,sundhedspleje,certainexistbackhighestfaceuponfencingnarininglalanakabulagtang