Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

19 sentences found for "god"

1. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

2. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

3. Different religions have different interpretations of God and the nature of the divine, ranging from monotheism to polytheism and pantheism.

4. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

5. En god samvittighed kan være en kilde til personlig styrke og selvtillid.

6. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

7. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

8. Many people turn to God for guidance, comfort, and solace during difficult times in their lives.

9. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

10. Min erfaring har lært mig, at det er vigtigt at have en god arbejdsetik.

11. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

12. Thank God you're OK! bulalas ko.

13. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

14. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

15. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

16. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

17. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

18. Thor possesses god-like strength and wields a powerful hammer called Mjolnir.

19. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

Random Sentences

1. Kailangan kong magtiwala sa aking sarili upang maalis ang aking mga agam-agam.

2. Bakit anong nangyari nung wala kami?

3. Bakit kayo nagtungo sa Mendiola?

4. Grabe naman ang lockdown na yan ilang buwan na.

5. Eh? Considered bang action figure si spongebob?

6. Galit na galit ang ina sa anak.

7. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

8. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

9. Ano ang binibili namin sa Vasques?

10. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

11. Aling hayop ang nasa tabi ng puno?

12. Ang lalaki ng paniki na aming nakita.

13. Nagsagawa ng ritwal si Matesa upang sumpain ang anak ng mag-asawa.

14. The invention of the telephone led to the creation of the first radio dramas and comedies

15. Sino-sino ang mga inimbita ninyo para manood?

16. Helte kan inspirere os til at tage positive handlinger i vores eget liv.

17. Pumasok po kayo sa loob ng bahay.

18. The company acquired assets worth millions of dollars last year.

19. Mas maganda kung magbigay tayo ng oras at atensyon sa mga kabuluhan kaysa sa mga kababawan.

20. Nagsisilbi siya bilang guro upang ituro sa kanyang mga estudyante ang tamang edukasyon.

21. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

22. Malulungkot siya paginiwan niya ko.

23. Nagpaabot ako ng bulaklak sa kanyang bahay upang ipakita ang aking pagmamahal sa nililigawan ko.

24. It's nothing. And you are? baling niya saken.

25. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

26. Winning a lottery or a big prize can create a sense of euphoria and disbelief.

27. Bawat pook ay may kanya kanyang alintuntunin.

28. We all know that he's struggling with addiction, but nobody wants to talk about the elephant in the room.

29. Disente naman talaga ang kanilang pamilya.

30. Elektroniske apparater kan hjælpe med at forbedre undervisning og læring i uddannelsessystemet.

31. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

32. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

33. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

34. Paano ako pupunta sa Intramuros?

35. She admired the way her grandmother handled difficult situations with grace.

36. When in Rome, do as the Romans do.

37. Nakakuha kana ba ng lisensya sa LTO?

38. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

39. A couple of candles lit up the room and created a cozy atmosphere.

40. Scissors should be handled with care to avoid injuries and kept out of reach of children.

41. Nagsisilbi siya bilang security guard upang protektahan ang mga tao at ari-arian.

42. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

43. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

44. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

45. Inalalayan ko siya hanggang makarating sa abangan ng taxi.

46. Algunas culturas consideran a las serpientes como símbolos de sabiduría, renacimiento o incluso divinidad.

47. Napuno ako ng poot nang malaman ko ang mga kasinungalingan na ibinato sa akin.

48. Maramot siyang magpahiram ng kanyang mga libro dahil takot siyang masira ang mga ito.

49. The United States has a system of separation of powers

50. El arte es una forma de expresión humana.

Similar Words

NapagodpagodnakakapagodmapagodmagpapapagodMangungudngodHinagud-hagodnalugoduugod-ugoduugud-ugodsumugodgodt

Recent Searches

prospercebuurigoditinaliellalarrybirogandapowersinabisinongmapuputinaritodolyarmajorkarangalanshareageordertiposnaggingcespopulationadditionallynaroonipapainitpinalakinghoweveraidpracticadobumabamulti-billionsingeraddsulinganochandoconectantrackwealthbridedaigdigilanagilityataauditschedulemeanfigurespalayanprocessdevelopdospatrickandroidcharitableentrysettingvisualguidemanagerconditionilinghighestinformedwhetherfrogipihitdingdingsambitonlyrepresentedcountlessmainstreamestablishedactivityskilllimitbitawancleanclientesmotionroquesafesunud-sunuranrektanggulokakuwentuhannakayukoipinangangakanotheragostoh-hoydasalmulighederkayolawsnahigitanbulalassandalimatikmanrenatopangalanipapaputolvisttanawinmagpagalingipagbilipamanhikanultimatelybumahamalambingkamalianbackpackmapapaclassesmaitimboyetsakristannakadapanakangisibestfriendnamamanghamagbayadtatlumpungpinagkiskispaglalaittatawagannagpabayadnanahimiksermakatarungangtig-bebenteliv,mahiwagangmonsignorbloggers,pagkabuhayhitsuraeconomykumikinignapakagagandahila-agawanvirksomhederkagalakankapangyarihannagpaiyaklumiwagnalalabinakakasamanalalamannagtungonapapatungocandidaterenombrepinagpatuloykumbinsihinmakakasahodkumakalansingbaranggaynaninirahannapakagandangnageenglishpare-parehopinakamagalinglaki-lakipagpapakalatgeologi,makikipag-duetomagkasintahanikinagagalakmagkikitamagpa-ospitalnakakapagpatibaynagkakatipun-tiponnangagsipagkantahannasabisagasaanmasaksihankasintahannapakalusogpinasalamatanromanticismoiloilopalaisipantitapambahaykamakailankalaunannanlakigandahankusineroibinibigaymagtataasumiinompinapalokubyertoskanikanilangpagkagustonagmistulanghiwa