Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "hate"

1. Bawal magpakalat ng mga hate speech dahil ito ay nakakasira ng kalagayan ng mga taong napapalooban nito.

2. I hate it when people beat around the bush instead of just getting to the point.

3. The internet has also made it easier for people to access and share harmful content, such as hate speech and extremist ideologies

4. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

Random Sentences

1. Sa dami ng nagnanais kumuha ng kursong iyon, mababa ang tiyansa niyang makapasok.

2. El powerbank se carga conectándolo a una fuente de energía, como un enchufe o una computadora.

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

4. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

5.

6. She has learned to play the guitar.

7. It is a form of electronic communication that transmits moving images and sound to a television set, allowing people to watch live or recorded programs

8. Nami-miss ko na ang Pilipinas.

9. Kenji nandito na siya! sabi sa akin ni Grace.

10. Ang pagiging multi-talented ni Rizal ay nagpakita ng kanyang kabatiran at kagalingan sa iba't ibang larangan ng pagpapakilos.

11. Estudyante sina Rita at Fe sa UP.

12. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

13. Ang kaniyang galak ay animo'y nakakahawa, nagbibigay saya sa lahat ng nakapaligid.

14. Di ko sya maistorbo dahil sya ay nag-aaral pa.

15. Anong nakakatawa? sabay naming tinanong ni Sara

16. He has written a novel.

17. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

18. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

19. The acquired assets were carefully selected to meet the company's strategic goals.

20. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

21. The movie was absolutely captivating from beginning to end.

22. Sakay na! Saan ka pa pupunta?!!

23. Magsasalita na sana ako ng sumingit si Maico.

24. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

25. Pwede ko ba malaman ang password ng inyong wifi?

26. Tinawag nya kaming hampaslupa.

27. El amor todo lo puede.

28. Mon mari a fait une surprise pendant notre cérémonie de mariage.

29. The stock market can be influenced by global events and news that impact multiple sectors and industries.

30. Ano ang nangyari sa Compostela Valley?

31. This has led to a rise in remote work and a shift towards a more flexible, digital economy

32. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

33. Magdamag kong naiwang bukas ang ilaw.

34. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

35. Mahalaga na magtulungan tayo upang maabot ang ating mga pangarap bilang isang grupo o komunidad.

36. Put all your eggs in one basket

37. Triggering is a key feature of oscilloscopes, allowing users to stabilize and synchronize waveforms.

38. Orang tua bayi sering kali merayakan hari ulang tahun anak mereka setiap tahunnya dengan acara yang meriah.

39. Some people enjoy adding cream, sugar, or other flavorings to their coffee to enhance its taste.

40. Ang resiliency ng mga Pinoy ay patunay ng kanilang lakas sa harap ng pagsubok.

41. El nuevo libro de la autora está llamando la atención de los lectores.

42. Masakit para sa isang ina ang sinapit ng kanyang anak ngunit masaya sa kaloobang tinanggap iyon ni Busyang.

43. Gusto ko hong magpapalit ng dolyar.

44. Gaano ka kadalas uminom ng bitamina?

45. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

46. Albert Einstein was a theoretical physicist who is widely regarded as one of the most influential scientists of the 20th century.

47. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

48. Sino ang binilhan mo ng kurbata?

49. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

50. Kung alam ko lang na ganito kasakit ang magiging parusa ko

Similar Words

whatever

Recent Searches

fallhategenerababalatredigeringadangmakasarilingdemocracyarguehoteladdictioninalagaaniniisipkaysaiconscniconamatrajepresleymagalangparkingconsume1954panindangrosellemagtatampomagtagocassandrapepepabalangoperahanniyanestarallottedinabotilangtaingaletterhanggangreportnagawangmabilisbusyangeffortsmagpuntasaanusaso-calledmemorialharinggranpostcardsumabogprimerduriuncheckedbinigyangmeetglobalpasyaagilitymacadamiaabstainingtransitspecializednagreplycountrieseksenaspeedofterelobadmadridgodtmagtipidmangemedyocoursesdatinapilitangpakisabisumimangotatensyonbumilidumilimwifiestiloslaruanvideos,magtatagalnagbungafurybaulrosepagdidilimalmusalvirksomheder,mahabamagpa-checkupkadalagahangedit:merlindaanibersaryopinagpatuloyerhvervslivetcarsspreadnaglalaromatapobrengnakaririmarimmaibibigayhumalokomedormakidalobiologipagpapasanbeautymahuhusaypalancabataytumatanglawpinakidalatumatawagkapaligirannasiratagaytayhandaanambisyosangkumaenpang-araw-arawstorybukaspabigatinagawnaglokohannai-dialendalanganbulalasisinagotpinansinkainitancapacidadmatutulogmusicalpagpalitkutsaritangtrainingnabasatumingalakargahanliligawannaghubadlalargadisensyonobodyindependentlypampagandanilayuanpayongcarriesanakulangkalongnapagtantomakaratinglikesnunosinumangbahay-bahaypanaypitoelitebakitdenelectioniosetolockdownabanganpetsasaringreservationcoatpelikulasinisiralibagpanciteditcertainrepresentativestructurebranchdelescienceginisingorderrolledkahitwork