Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "want"

1. All these years, I have been discovering who I am and who I want to be.

2. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

3. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

4. Haha! I'd want to see you fall inlove tonight.

5. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

6. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

7. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

8. I don't want to beat around the bush. I need to know the truth.

9. I don't want to cut corners on this project - let's do it right the first time.

10. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

11. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

12. I don't want to spill the beans about the new product until we have a proper announcement.

13. If you don't want me to spill the beans, you'd better tell me the truth.

14. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

15. If you want to get the best deals at the farmer's market, you have to be the early bird.

16. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

17. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

18. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

19. Oo naman. I dont want to disappoint them.

20. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

21. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

22. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

23. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

24. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

25. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

26. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

27. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

28. There are a lot of books on the shelf that I want to read.

29. Think about what message you want to convey, who your target audience is, and what makes your book unique

30. Tumango ako, you want? alok ko sa kanya.

31. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

32. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

33. You have to push yourself to the limit if you want to succeed - no pain, no gain.

Random Sentences

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

2. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

3. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

4. Walang anuman saad ng mayor.

5. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

6. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

7. Awitan mo ang bata para makatulog siya.

8. Para cosechar la miel, los apicultores deben retirar los panales de la colmena.

9. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

10. All these years, I have been cherishing the relationships and connections that matter most to me.

11. Nang tayo'y pinagtagpo.

12. Instagram is a popular social media platform that allows users to share photos and videos.

13. In the land of Narnia, four siblings named Peter, Susan, Edmund, and Lucy discover a magical wardrobe.

14. Bawal kang mapagod.. papagalitan nila ako pag napagod ka..

15. Sa di-kawasa ay dumating ang malungkot na sandali.

16. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

17. Ang sugal ay maaaring magdulot ng pagkawala ng pag-aasenso at pagkakataon sa buhay.

18. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

19. Después del nacimiento, la madre necesitará tiempo para recuperarse y descansar, mientras que el bebé necesitará atención constante y cuidado.

20. Time heals all wounds.

21. The teacher assigned a hefty amount of homework over the weekend.

22. Tantanan mo ako sa legend legend na yan! hahaha!

23. These algorithms use statistical analysis and machine learning techniques to make predictions and decisions.

24. Ngunit parang walang puso ang higante.

25. Jeg er i gang med at skynde mig at få alt færdigt til mødet. (I'm in a hurry to finish everything for the meeting.)

26. Mange mennesker bruger påskeferien til at besøge kirkegårde og mindes deres kære.

27. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

28. Sayur asem adalah sup sayuran dengan bumbu yang asam dan pedas.

29. Las personas pobres son más vulnerables a la violencia y la delincuencia.

30. Has she read the book already?

31. If you don't want me to spill the beans, you'd better tell me the truth.

32. Ang tula na isinulat niya ay ukol kay Romeo na matalik niyang kaibigan.

33. Sa paglutas ng mga palaisipan, mahalaga ang pagkakaroon ng positibong pananaw at pagpapakita ng determinasyon.

34. Anong oras mo gustong umalis ng bahay?

35. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

36. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

37. Me encanta el aroma fresco de las hierbas recién cortadas.

38. Pinahiram ko ang aking gamit pang-camping sa mga kaibigan ko para sa aming weekend getaway.

39. Sa tingin mo ba may balak ako? he grins.

40. Masahol pa kayo sa mga hayop! Dahil sa inyong makasariling pagnanasa ay nagawa ninyong saktan ang ibang tao.

41. Soto ayam adalah sup ayam yang dimasak dengan rempah-rempah Indonesia khas.

42. He has improved his English skills.

43. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

44. Nag-aaral siya sa Seasite bawat araw.

45. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng insomnia o hindi makatulog sa gabi.

46. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

47.

48. Tinuruan niya ang kanyang anak na maging magalang sa mga nakatatanda.

49. Les travailleurs peuvent obtenir des avantages supplémentaires tels que des bonus ou des primes pour leur excellent travail.

50. Lontong sayur adalah hidangan nasi lontong dengan sayuran dan bumbu yang khas Indonesia.

Recent Searches

niyanmaaksidenteboyfriendjolibeesahodwantpagpalitunangsasapakinestadosnaturalwednesdayhanginorganizenagisingiyakkontingcapacidadadditionally,manilaaguapaldaricoindependentlyaregladofilmspabalangnagdarasalindiabasahinaffiliatenuhmalumbaypatunayanmalambingparkebinatangsagaplarongbateryawaringnetocapacidadesorasankaawayoperahanaywanfeedback,1980cardtonnakasuotxixlaryngitisgrinssparemassesproductionreboundhdtvasthmalaki-lakisumaliforcespasananipulatekstmulihanmillionssubjectotrasideascoaching:votespookconcernbayaananongnababalotbadhelpfultargetdaigdigeducationaloperategamefanscommunicationsipinagbilinghariiniselectionlaterinalalayanpinagsanglaanrequiresettingprogramsfallinterviewingfencingminamadalitechnologiesbaldemind:talecrazyslaveroqueipagtimplahoweverberegningerbagalpansitkahaponsinasagotkinikilalangexcuselinesupplykalikasanpinangtilalandediliginanghelmatagumpayaudio-visuallykaagawkuripotcirclemadungisnapahintomaiingaydamithigpitangantingpowerbarongpinakamaartengmagkaibigankinagagalakobra-maestrapagkakalutoinaasahangnagkakasyanagbabakasyonnagtatakbonalulungkottinulak-tulaksportsmakakasahodhumalakhaknagpepekenakuhangcultivakumikinignasasabihannagnakawbinibiyayaanpaglalaitnakalagaynasasakupanpumapaligidnagpaiyakpamanhikannagsisigawkabutihanuugod-ugodtitamedicalpaglakisasamahanteknologipagkatakotkubyertosnakakarinigmakasilongmagkapatidnagreklamonakatapatdiscipliner,nagpapasasatemperaturapabulongmagtakaalapaapestasyonvidenskabisinagotpagamutannangangakoasignaturaintindihinpuntahannakasakitngumiwialagang