Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

33 sentences found for "want"

1. All these years, I have been discovering who I am and who I want to be.

2. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

3. Electric cars can be a viable option for individuals who want to reduce their carbon footprint and contribute to a more sustainable future.

4. Haha! I'd want to see you fall inlove tonight.

5. Hendes livsstil er så fascinerende, at jeg ønsker at lære mere om hende. (Her lifestyle is so fascinating that I want to learn more about her.)

6. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

7. I didn't want my sister to know about the family vacation, but my mom let the cat out of the bag by accident.

8. I don't want to beat around the bush. I need to know the truth.

9. I don't want to cut corners on this project - let's do it right the first time.

10. I don't want to get my new shoes wet - it's really raining cats and dogs out there.

11. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

12. I don't want to spill the beans about the new product until we have a proper announcement.

13. If you don't want me to spill the beans, you'd better tell me the truth.

14. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

15. If you want to get the best deals at the farmer's market, you have to be the early bird.

16. If you want to maintain good relationships, don't burn bridges with people unnecessarily.

17. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

18. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

19. Oo naman. I dont want to disappoint them.

20. Quiero aprender un nuevo idioma para comunicarme con personas de diferentes culturas. (I want to learn a new language to communicate with people from different cultures.)

21. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

22. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

23. Quiero ser dueño de mi propio negocio en el futuro. (I want to own my own business in the future.)

24. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

25. Quiero ser una influencia positiva en la vida de las personas que me rodean. (I want to be a positive influence in the lives of people around me.)

26. Quiero tener éxito en mi carrera y alcanzar mis metas profesionales. (I want to succeed in my career and achieve my professional goals.)

27. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

28. There are a lot of books on the shelf that I want to read.

29. Think about what message you want to convey, who your target audience is, and what makes your book unique

30. Tumango ako, you want? alok ko sa kanya.

31. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

32. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

33. You have to push yourself to the limit if you want to succeed - no pain, no gain.

Random Sentences

1. Hindi ako usually ganto, pero sana pwede ba kita makilala?

2. At have en sund samvittighed kan hjælpe os med at opretholde gode relationer med andre mennesker.

3. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

4. Every year, I have a big party for my birthday.

5. She has finished reading the book.

6. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

7. A continuación se detallan los pasos para cultivar maíz en casa o en un pequeño huerto

8. Mabuhay ang bagong bayani!

9. Starting a business during an economic downturn is often seen as risky.

10. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

11. Palibhasa ay madalas na nagkakaroon ng mga insights sa mga bagay na hindi pa naiisip ng ibang mga tao.

12. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

13. A father is a male parent in a family.

14. Walang humpay ang pagdudugo ng sugat ng tigre kaya agad agad itong kumaripas ng takbo palayo sa kweba.

15. The dog barks at the mailman.

16. Sa pagguhit, puwede ka rin mag-experiment ng iba't-ibang kulay at matutunan ang mga color combinations.

17. El amanecer en la montaña es un momento sublime que nos conecta con la naturaleza.

18. Limitations can be physical, mental, emotional, financial, or social.

19. Maraming bayani ang nag-ambag ng kanilang talino at kaalaman upang mapabuti ang kalagayan ng bayan.

20. Hindi ko maaaring payagan ang aking mga agam-agam na hadlangan ang aking mga pangarap.

21. Siempre hay esperanza, incluso en las situaciones más difíciles. (There is always hope, even in the most difficult situations.)

22. Nakatitig siya sa tatlo pa niyang kapatid.

23. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

24. One of the most significant impacts of television has been on the way that people consume media

25. The bookshelf was filled with hefty tomes on a wide range of subjects.

26. Nationalism is a political ideology that emphasizes the importance of the nation-state.

27. Natutuwa ako sa magandang balita.

28. Ang magnanakaw ay nakunan ng CCTV habang papalapit ito sa tindahan.

29. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

30. Gustong pumunta ng anak sa Davao.

31. Ang bituin ay napakaningning.

32. Don't be fooled by the marketing gimmick, there's no such thing as a free lunch.

33. Banyak jalan menuju Roma.

34. Pedeng ako na lang magsubo sa sarili ko?

35. The anonymity of cryptocurrency transactions has led to concerns about money laundering and terrorist financing.

36. El paisaje que rodea la playa es sublime, con sus aguas cristalinas y suave arena.

37. Muchas personas luchan con la adicción a las drogas y necesitan ayuda para superarla.

38. Congress are elected every two years in a process known as a midterm election

39. Les enseignants sont souvent formés dans des écoles de formation des enseignants.

40. The objective of basketball is to shoot the ball through a hoop that is mounted 10 feet high on a backboard.

41. Nakita niya ata ako kaya tinigil niya yung pagsasalita niya.

42. Many religious traditions believe that God is all-knowing, all-powerful, and benevolent.

43. Ang albularyo sa kanilang baryo ay kilala sa kanyang kaalaman sa herbal medicine.

44. Habang nag-oorasyon nagising si Mang Kandoy dahil sa mga bulong ng salamangkera.

45. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

46. Omelettes are a popular choice for those following a low-carb or high-protein diet.

47. Lumabas na ako ng cr. Nakatayo lang ako dun.

48. Madali ka nitong bibigyan ng paninda kung may sarili kang bangkang paghahanguan ng mga huling isda sa karagatan.

49. Time heals all wounds.

50. Ipaghanda mo si Lina ng Maghanda ka ng damit

Recent Searches

wantmauupomiyerkulesayanapagtuunanbabayarannagkabungabigyanundeniablekinuhahmmmmhamaknasasaktanprimerasnaglinisfulfillingpamamahingapagkaingaksiyonlupainhawaiidawsakasumagotsumugodsumapitsumasagotngunitsumusulatsulatkaraokeplasabinigyanmedidapatongblusakapatawarannagpapaypayactingnamataypinalalayasenerokangitanmamanhikankandidatopag-isipansagotklasehumahagokmaligayajemibadmakitasaritalovepagtataasentertainmentwesterntsekuwartongpeer-to-peeralamwaringtelefonernagtitindainutusanharinagawangdogbakawaitertuwapaligidkaninoinformedtugianiunangscalesparktaong-bayandivisionsampaguitamababawtrabahohospitalbinulongmismoitaasgagandanapaghatianayosvoresditodisyembrealituntuninitspagtuturopasensiyapinabilistuffedhikingnag-away-awaynatulogmakahingiseguridadcornersmarvintinurohappenednararapatdinukottinutopyanstatusmangahasnasaktanmalakasberkeleykumakantajuanatransportmidlernakaakmasabernatiratradehanap-buhaylossnagkakatipun-tiponbumotonetomagtataasligayawhatsappfacetoothbrushpracticeswhichpinuntahandalawangsilyalandetthoughprogrammingkaraniwangsuelokanyaakosumigawsiguradokatipunanninanaispag-asanakadapanagsisigawsagutinfatalrektanggulofindedemocratictiyonagisingpaliparinnegosyorevolucionadopag-iwantahimikinvitationmasayamasayang-masayapapanigmasipagdalhinmagtigildemocracyeffortsmrslibagnanahimiktataasalas-diyesnapawipinyuandagattanawinnglalabadraft:makatayoilagaydaddysaranggolaformsapelyidogandahanngititipidandrepinipilitalongnever