Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "west"

1. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

2. Los Angeles, California, is the largest city on the West Coast of the United States.

3. Some of the greatest basketball players of all time have worn the Lakers jersey, including Magic Johnson, Kareem Abdul-Jabbar, Jerry West, Elgin Baylor, and Kobe Bryant.

4. The sun does not rise in the west.

Random Sentences

1. You need to pull yourself together and face the reality of the situation.

2. She has won a prestigious award.

3. Schönen Tag noch! - Have a nice day!

4. Salamat sa iyo kaibigan, nailigtas mo ako sa kamay ng itim na salamangkera.

5. Ate Annika! Gusto ko yung toy! Gusto ko yung toy!

6. Ang mga magsasaka sa aming probinsya ay pinagsisikapan na mapanatili ang masaganang ani sa kanilang mga bukirin.

7. The patient was discharged from the hospital after recovering from pneumonia.

8. The director shouted "break a leg!" as we went onstage.

9. Está claro que la evidencia respalda esta afirmación.

10. Ang pangamba ay maaaring maging dahilan ng pagkakaroon ng stress at pagkalungkot.

11. Gracias por ser una inspiración para mí.

12. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

13. They have been dancing for hours.

14. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

15. Kinuha naman nya yung isang bote dun sa lamesa kaso.

16.

17. Marahil ay nai-stress ka dahil sa mga kailangang tapusin sa trabaho.

18. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

19. La tos puede ser un síntoma de neumonía.

20. Einstein's work led to the development of technologies such as nuclear power and GPS.

21. Dumating ang mga kamag-anak ni Fe.

22. Sa matinding takot ay nagsunuran ang mga mangingisda sa di nila nakikilalang matanda.

23. Promise yan ha? naramdaman ko yung pag tango niya

24. Forgiveness is a virtue that promotes peace, healing, and a greater sense of connection with ourselves and others.

25. Kinagalitan si Bereti at pinauwi ngunit ayaw sumunod ng bata.

26. Representatives often hold regular meetings or town halls to connect with their constituents and gather feedback.

27. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

28. Eh bakit mo binili para sa kanya yun kung ganun?

29. Sa kaibuturan ng aking puso, alam kong tama ang aking ginagawa.

30. Ang kalayaan ay hindi dapat magdulot ng pang-aabuso sa kapwa.

31. Hindi ko alam kung bakit ang ibang tao ay madalas na mangiyak-ngiyak sa kahit anong bagay.

32. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

33. Emphasis is an important tool in public speaking and effective communication.

34. The scientific community is constantly seeking to expand our understanding of the universe.

35. Durante su carrera, Miguel Ángel trabajó para varios papas y líderes políticos italianos.

36. Tinanggal ko na yung maskara ko at kinausap sya.

37. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

38. She is not playing the guitar this afternoon.

39. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

40. Wag mong ibaba ang iyong facemask.

41. Los desastres naturales, como las inundaciones y sequías, pueden tener un impacto significativo en el suministro de agua.

42. There were a lot of flowers in the garden, creating a beautiful display of colors.

43. Naglinis kami ng bahay noong Linggo.

44. Basketball requires a lot of physical exertion, with players running, jumping, and moving quickly throughout the game.

45. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

46. Hindi dapat natin hayaang mayroong paglapastangan sa mga pangalan ng mga namayapa.

47. Ang paglapastangan sa ating mga tradisyon at kultura ay isang pagkawala ng ating pagkakakilanlan.

48. Ang pabango ni Lolo ay nagbigay ng mabangong amoy sa kanyang kuwarto.

49. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

50. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

Similar Words

pwestoWestern

Recent Searches

westanimoysumakaymalimitnaggingbarneslalakekumbentoilogpodcasts,advancementpambahaypackagingdakilangmabaitdulotpag-aminsasayawindesign,wasakheftyiilantoolsbesesmodernebikolnanggagamotlumakimarketing:hinihintaymaglarokanginajingjingnapuyatkolehiyoyoutheskuwelahanikinatatakotpinagsikapanpromotingexitilanpaslitcondoadvancedellaaniisasagotmateryalespinigilankondisyonlumibotmanatiliwatawatmapapansinmensahekasintahannapapalibutantinaasanmalezamumurangingisi-ngisingmang-aawitkinikitaoktubrepagpilititacultivakapangyarihanpaglalaitcombatirlas,tungolumipadperyahankesonaglutokakilalagumigisingreserbasyonreynaeffectappinterviewingbathalastagecorrectingmaranasanaayusinhanapinpakilagaysasapakinmakilalapinipilitbilangguanomfattendepokereleksyonbopolskapalbiglaanlakadlaganapmasdanharingpartyplacebangcivilizationbecomingwordnagawa4thapoyoveralllinawmalihisnogensindewastemaistorbomagdaanbestida00amiikliblazinghinigitbevarebinilhanbuenawashingtonrichsparkdevelopedipagamotwordsmemorialconectadosniliniskotsemangnagyayangmakalingnakapamintanamahinogskyldesmarahasnagpakilalamasamangnatatawangmiraitinatapatlimahant-isabundokagesaidnami-misspracticadojannyopagbubuhatanpagdatingnabagalankaragatanchangemapakalirefersbinabaanfacebookstevepersonalpagepitakalayout,addsedentaryenforcingmoreborndinaddressdragoncontroversynanlilimahiddistansyamakalaglag-pantysakimincludeusingawarecomunicarsecreatingreallyanimthereroquenakapagproposepakikipaglabantumatakbonapasubsobmagtago