Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "euphoric"

1. After finishing the marathon, the runner was euphoric with their achievement.

2. After months of hard work, getting a promotion left me feeling euphoric.

3. Dancing all night at the club left me feeling euphoric and full of energy.

4. The experience of bungee jumping was both terrifying and euphoric.

5. The feeling of accomplishment after completing a difficult task can be euphoric.

6. The feeling of falling in love can be euphoric and overwhelming.

7. The feeling of finishing a challenging book can be euphoric and satisfying.

8. The singer's performance was so good that it left the audience feeling euphoric.

9. Winning the championship left the team feeling euphoric.

Random Sentences

1. Sumagot agad si Kuya isang ring pa lang.

2. Ang taong lulong sa droga, ay parang nakakulong sa isang piitan na hindi makalabas.

3.

4. Gigising ako mamayang tanghali.

5. Adopting sustainable agriculture practices can help reduce the environmental impact of food production.

6. Ailments can be a source of stress and emotional distress for individuals and their families.

7. They are building a sandcastle on the beach.

8. Sa anong tela yari ang pantalon?

9. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

10. We have been married for ten years.

11. Todos necesitamos algo en qué creer y esperar en la vida. (We all need something to believe in and hope for in life.)

12. Ang problema niya nga lang ay sadyang malayo ang paaralan sa palasyo kaya kinausap niya si Helena tungkol sa bagay na iyon.

13. Ang pabango ni Lolo ay nagbigay ng mabangong amoy sa kanyang kuwarto.

14. They are singing a song together.

15. Napakainit ng panahon kanina at biglaan kaming nagpasyang mag-swimming.

16. Oo malungkot din ako. Mamimiss kita.

17. Claro, haré todo lo posible por resolver el problema.

18. Sa eroplano, hinde ko mapilitang hinde malungkot.

19. Allen "The Answer" Iverson was a lightning-quick guard known for his scoring ability and crossover dribble.

20. Kings have held power throughout human history, from ancient civilizations to modern times.

21. My mom always bakes me a cake for my birthday.

22. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

23. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

24. Hindi maganda na supilin ang kalayaan ng mga mamamahayag sa bansa.

25. Biglaan ang pag-ulan kanina kaya ako ay nabasa nang husto.

26. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

27. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

28. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

29. Nakangisi at nanunukso na naman.

30. He has traveled to many countries.

31. The company's CEO announced plans to acquire more assets in the coming years.

32. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

33. Cancer is a group of diseases characterized by the uncontrolled growth and spread of abnormal cells in the body.

34. I saw a beautiful lady at the museum, and couldn't help but approach her to say hello.

35. Mathematics is a language used to describe and solve complex problems.

36. The authorities were stumped as to who the culprit could be in the unsolved case.

37. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

38. Taking unapproved medication can be risky to your health.

39. Buti na lang medyo nagiislow down na yung heart rate ko.

40. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. The detectives were investigating the crime scene to identify the culprit.

43. Les enseignants peuvent dispenser des cours de rattrapage pour les élèves qui ont des difficultés à suivre les cours.

44. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

45. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

46. In the early days, telephones were connected to a central switchboard, which connected calls manually

47. I have been studying English for two hours.

48. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

49. Det har også ændret måden, vi producerer ting og øget vores evne til at fremstille emner i større mængder og med højere præcision

50. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

Recent Searches

euphoricsetsbisitakasangkapansweetnakangisipinakabatangnasiyahanrenacentistabihirangusatenidotelangnakangisingstorypinagmamalakiliv,transportadvertisingnuevospundidolipathawaiibumiliconclusion,consisttelamagagandangnatitirakaraokeflaviopnilitmaskinermatagpuanmagtatagalbabasahinbarreraslegendsmakalaglag-pantygamenagpipiknikdeletingzooreplacedbubongflexiblebeginningscallingspecializedclasesdolyarpagkakatayotomorrowjuegosnagwikangskills,baguionapakalusogunanmagpahabapagkakapagsalitakainitangovernorsmustnakakasamanilangnalalaglaglivepamilyamagkabilangengkantadanglaruansuzetteniyoggusalibalancespaghihingalomagpasalamateditorextramakatarungangdiagnoses10thmaibibigaytumaposbisikletatutungocomunicarsemagbalikkassingulanggownmagbayadmasaksihanpopcornniligawanpaghingiwonderisulatlimostumatawadstatingoverdigitalavailablefertilizerpangingimiandypinunitnangangalitbringelitefurthercollectionsikinalulungkotpa-dayagonalautomationso-calledpromiseworkshopsettinginaapihulingcomputere,stevegenerabamagsaingthirdasignaturamenubehalfumikotmanakbobumalikmanoodbigkisreservesarmedalwayssaan-saannakatitiyaksequetumabihadpasensyanatatanawpagdukwanggayunpamansapagkatemphasispangulobuhokgotmanilbihanpaladulannakaprutasbakuranpamangkinlapisnalalabingnagbabasakommunikerernakangangangpronounaminsakamulanotebookteacherkontramakipagtagisantinanggapeducationkasingtigasnag-away-awaybumabalotprobinsyapag-aminsisteredukasyonnyahawladumilatmommytwinkleumanoipinapoloilawnegosyantetinatanongawardbasketbolkinikitaamparogamesgovernmenttreatsnakasahod