Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "additionally,"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

3. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

4. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

5. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

6. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

7. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

8. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

Random Sentences

1. Arbejdsgivere tilbyder træning for at forbedre medarbejderes færdigheder.

2. Sa pagtulog, ang katawan ay nagpapalakas at nagpaparegla ng mga proseso nito.

3. Nakikini-kinita niya ang paghugos ng mga mangingisda.

4. Oo naman 'My! Walang hihigit pa sa Beauty ko noh.

5. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

6. Ang pag-ulan sa labas ay animo'y nagpapaligaya sa mga halaman sa hardin.

7. Representatives engage in negotiations and compromise to find common ground and reach consensus on complex issues.

8. Amazon has a vast customer base, with millions of customers worldwide.

9. Mukhang masarap ang prutas ngunit wala sino man ang mangahas na kumain nito sapagkat ang mga bunga ay lason.

10. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

11. Pinamunuan niya ang mga Pilipino laban sa mga Espanyol at kalaunan sa mga Amerikano.

12. My girlfriend looked like a beautiful lady when she walked down the stairs in her new dress.

13. Saan na po kayo nagtatrabaho ngayon?

14. Håbet om at finde kærlighed og lykke kan motivere os til at søge nye relationer.

15.

16. Sa pagdaan ng panahon, yumabong ang kultura ng pagbibigay ng regalo tuwing Pasko.

17. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

18. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

19. Adik na ako sa larong mobile legends.

20. Tila may lihim siyang itinatago sa atin.

21. Tumagal ng tatlong oras ang kanyang operasyon.

22. Samahan mo muna ako kahit saglit.

23. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

24. Si Juan ay nangahas na magtapat ng pag-ibig kay Maria sa kabila ng kanyang takot na ma-reject.

25. Anong tara na?! Hindi pa tapos ang palabas.

26. Alam mo ba kung bakit takot si Cross sa hospital?

27. Les patients peuvent être transférés dans des unités de soins spécialisées en fonction de leur état de santé.

28. Mi amigo de la infancia vive ahora en otro país y lo extraño mucho.

29. Lumiwanag ang mukha ni Ana nang makita ang resulta ng exam.

30. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

31. They have organized a charity event.

32. Lumalaon ay dumarami ang tao sa paligid at ang pulis na umuusig ay tila siyang-siya sa kanyang pagtatanong at pagsusulat sa kuwaderno.

33. Hockey coaches develop game plans and strategies to help their team succeed.

34. The United States has a diverse landscape, with mountains, forests, deserts, and coastal regions.

35. "The more people I meet, the more I love my dog."

36. Nagpalipad ng saranggola si Juan sa bukirin.

37. Puwede bang makausap si Maria?

38. Sa panahon ngayon, mahirap makahanap ng mga taong bukas palad dahil sa kahirapan ng buhay.

39. Sumang ayon naman sya sa mungkahi ng kanyang kasintahan.

40. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

41. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

42. Nationalism can also lead to a sense of superiority over other nations and peoples.

43. Los blogs y los vlogs son una forma popular de compartir información en línea.

44. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

45. Nakisakay ako kay Jose papunta sa airport.

46. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

47. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

48. Facebook Live enables users to broadcast live videos to their followers and engage in real-time interactions.

49. Ang sabon na may pabangong rosas ay nag-iwan ng mabangong amoy sa aking balat.

50. Nakaka-bwisit talaga ang nangyari kanina.

Recent Searches

additionally,apologeticestatenakinigeffortsmasknatanggapsipalendingdettepersonalsumasambapageconnectingmallatinginawaapoypackagingnegativemakesreleasedrepresentedwebsitemalabomuchosdaanlulusogtomarmapuputiclientestoplightpakiramdambigsteermatabagoodlinenagingbituinmessagemapmastertypesdedicationdamdaminmanyhinagud-hagodhinihintaydividesvidtstraktna-suwaymagselosgumandanahintakutanrememberedku-kwentawonderparatingkwenta-kwentakundipesokumainpamilyamagdaraosconsideredmatangkadsulingantrafficyungtransportationnilayuangayunpamanpangangatawancontrolavanboxpagpapautangbundokrecibirgumawaiyakhumahangospagngitinagpatuloypinapakaindalawaseehigpitanmakidalohinanakitbakalnakikianaghubadnangingilidmurangfatherbumabagmasasabiberetibiggestwatchingbarriersincreasinglyyelotutoringthanktataastelefonlilipadnabiglakonsyertopakibigayisasamasnasuccesspriestdaladalawritinggumagamitnaiilaganhahatolpinamalagiconmagpakasalsakristanlipadkumikinigmahahanaynananaghilinanahimikmagkikitamagbabakasyontag-ulanairconpisianlabokinalakihanseguridadnovellespandidiripagkagisingtumalonincluirtahimikisinusuotnagtaposusuariopumulotniyospaghettihuwebeskasomapahamakkongkomunikasyonkontrasenioreclipxesumuotautomaticbilingbinilingdilagrealisticveryreservesshowsallottedpetroleumdiddenfriessupilininternaservicesconditioningendpamasahesoftwarepakilagaybetasikmuramatangnapabayaanfulfillmentnapaplastikannagmakaawageneratedmananaogkulotmangkukulamnaupotootumawagnakakalayosuwailpamimilhinkalalakihankilay