Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "additionally,"

1. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

2. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

3. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

4. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

5. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

6. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

7. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

8. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

Random Sentences

1. Sabi ko bumangon ka jan! Hoy!

2. ¡Claro que sí, acepto tu invitación!

3. Laughter is the best medicine.

4. I am listening to music on my headphones.

5. Cosechamos los girasoles y los pusimos en un jarrón para decorar la casa.

6. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

7. Nasa Pilipinas na si Raymond ngayon.

8. La prevención del uso de drogas es fundamental para reducir los índices de adicción.

9. Puwedeng gamitin ang pagguhit upang mag-drawing ng mga bagay na gusto mong ma-achieve sa buhay.

10. Ang mga pag-aaral sa kalusugang pang-mental ay nagbibigay-diin sa kahalagahan ng kamalayan sa mga isyu ng mental na kalusugan.

11. Claro, haré todo lo posible por resolver el problema.

12. Dahil sa matinding init, marami ang nagiigib ng tubig sa mga puno ng prutas upang hindi ito malanta.

13. Ang sinabi ng Dakilang Lumikha ay natupad.

14. La crisis económica produjo una gran inflación que afectó a los precios.

15. Maganda ang bansang Japan.

16. Maganda ang mga alaala ko dito sa Pilipinas.

17. Nauntog si Jerome sa kanilang pintuan.

18. Sa kanyang propesyonal na larangan, itinuturing siyang eksperto dahil sa kanyang natatanging abilidad.

19. I'm going to surprise her with a homemade cake for our anniversary.

20. Si Rizal ay nagbigay-inspirasyon sa maraming Pilipino na magkaroon ng katapangan at determinasyon sa kanilang pakikipaglaban para sa pagbabago at katarungan.

21. Kinakailangang kahit paano'y magkaroon tayo ng maihaharap na katibayang siya nga ang dumukot ng inyong kuwarta.

22. Paglingon ko, nakita kong papalapit sakin si Lory.

23. Nilinis ng mga taga-Tungaw ang kanilang maruming ilog.

24. Ang talambuhay ni Juan Luna ay nagpapakita ng kanyang husay at kagalingan bilang isang pintor.

25. Motion kan udføres alene eller sammen med andre, såsom i holdtræning eller sportsaktiviteter.

26. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

27. Naramdaman ko ang kanyang halinghing sa aking tainga dahil sa sobrang lalim ng kanyang paghinga.

28. Karaniwang mainit sa Pilipinas.

29. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

30. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

31. Huwag kang pumasok sa klase!

32. The community admires the volunteer efforts of local organizations.

33. Entschuldigung. - Excuse me.

34. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

35. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

36. Omelettes are a popular choice for those following a low-carb or high-protein diet.

37. Matagal na kitang nakikitang namumulot ng mga kahoy sa gubat na ito.

38. Writing a book is a long process and requires a lot of dedication and hard work

39. Bakit hindi kasya ang bestida?

40. Sa panahon ng digmaan, madalas na nagkakaroon ng migrasyon at pagkawala ng mga tao sa kanilang tahanan.

41. Hvert fødsel er unik og kan have forskellige udfordringer og glæder.

42. Miguel Ángel murió en Roma en 1564 a la edad de 88 años.

43. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

44. Masarap maligo sa swimming pool.

45. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

46. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

47. Coffee is a popular beverage consumed by millions of people worldwide.

48. Lasinggero ang tatay ni Gabriel.

49. Technology has also played a vital role in the field of education

50. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

Recent Searches

additionally,kabuhayannabigkascomputeryeahwindowformseffectsinaapicesmonetizingguiltyestablishednakikihalubilokahilinganpuntamaliliitlasingeronakadapanakayukonasakabundukanmakalipasenergy-coaljobsnapaiyaknakatirangdapit-haponbloggers,reynabumuhosrestawranstreeteksportenbagamamatikmanhinintaymabutidadalokubyertosjeetnapapatungogayunmanmakikipaglaronakakunot-noonggayundinhumalakhakunti-untingkalaronagyayangnakarinignagpasamamahahawainiirogiiwasankaliwaamuyinmalalakimahahalikambisyosangnananalongpakakatandaanmakakakaenh-hoycancersunud-sunuranpakikipagbabagleksiyontutungomagtigilnaghihirapkatutuborektanggulomahinogmasasayapinagawahayaangnailigtasipakitatinderadagat-dagatandolyararalshadeslumbaymukhacurtainsctricasgawahawlanuevosnagpasanmaghapongnahigitanmakaiponpaostumigillumabasbutikipabulongfysik,tumikimmagdaraosincidencekasaysayanwifisumingitbrasodasalinfluencessapotself-defensesocialeingatanorderincellphoneagadareasdiscoveredvistpataygaggoodeveninghiningibumugaworrymacadamianutrientescoatelectionspyestanathancryptocurrency:bienmaitimscientistintroduceexambatiultimatelyrabebisigadversebuslobranchbarnespagkakataoncigarettehoweverfarmapapabulsaidea:oftepopulationaddtrackbusnanghihinamadtilikatieattacktekanag-eehersisyomeetingpaanopanalangininhaletumawanakapaglaronapapadaanheartbreakchickenpoxbumaligtadarbejderpangkatgarbansosbinasakasawiang-paladpaladkamayumiiyakfar-reachingcentersamantalangisinaboypantalongnegosyonagbungaumiilingchambersengkantadanilapitanaga-agamagkakaanakna-suwayaksidentemaskanodyan