Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "capital"

1. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

2. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

3. Many companies use the stock market to raise capital by issuing new shares of stock to investors.

4. This can generate passive income for you, but it does require some capital to get started

Random Sentences

1. Ang tagumpay ng ating bayan sa larangan ng sports ay ikinagagalak ng buong bansa.

2. Si Josefa ay maraming alagang pusa.

3. He served as the 45th President of the United States from 2017 to 2021.

4. The bag of groceries was too hefty for the elderly woman to carry on her own.

5. The charitable donation made it possible to build a new library in the village.

6. Frustration can be a normal part of the learning process and can lead to personal growth and development.

7. Kapag hindi ka tumigil sa paggamit ng droga, magdudulot ito ng mas malalang kahihinatnan sa hinaharap.

8. Ang paglapastangan sa kalayaan ng pamamahayag at malayang pagpapahayag ay isang pagkitil sa ating demokratikong prinsipyo.

9. She helps her mother in the kitchen.

10. Dedicated teachers inspire and empower their students to reach their full potential.

11. Maaaring magbago ang pulitika ng isang bansa dahil sa digmaan.

12. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

13. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

14. The invention of the telephone led to the creation of the first radio dramas and comedies

15. Si te gusta la comida picante, prueba el guacamole con jalapeño.

16. Gusto ng ina na matuto si Pinang ng mga gawaing bahay, ngunit laging ikinakatwiran ni Pinang na alam na niyang gawin ang mga itinuturo ng ina.

17. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

18. Gusto ko sanang bumili ng bahay.

19. Limitations can be a source of motivation to push oneself to achieve more.

20. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

21. El cultivo de arroz requiere de un terreno inundado y condiciones climáticas específicas.

22. May pista sa susunod na linggo.

23. El nacimiento es el momento en que un bebé sale del útero de la madre.

24. Many charitable institutions rely on volunteers to sustain their programs.

25. Scissors have handles that provide grip and control while cutting.

26. Nahuli ang salarin habang nagtatago sa isang abandonadong bahay.

27. Cutting corners might save time now, but it will cause problems down the line.

28. Las vendas estériles se utilizan para cubrir y proteger las heridas.

29. Sige, tatawag na lang ako mamaya pag pauwi na ko..

30. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

31. Le stress et l'anxiété peuvent également avoir un impact négatif sur la motivation.

32. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

33. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

34. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

35. Ang poot ay nagpapalabo sa aking pananaw at nangunguna sa aking pag-iisip.

36. "Ang hindi magmahal sa sariling wika, daig pa ang malansang isda" ay isang bukambibig na nagpapahayag ng pagpapahalaga sa ating sariling wika at kultura.

37. We celebrated their promotion with a champagne toast and a slice of cake.

38. Eh gaga ka pala eh, gag show mo mukha mo.

39. Naramdaman ko ang kanyang halinghing sa aking tainga dahil sa sobrang lalim ng kanyang paghinga.

40. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

41. Ilang beses ka nang sumakay ng eroplano?

42. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

43. Proud ako sa kultura at tradisyon ng mga Pinoy.

44. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

45. Nationalism can also lead to authoritarianism and repression of dissent.

46. The cake is still warm from the oven.

47. They are singing a song together.

48. Two heads are better than one.

49. Ibinigay ko ang aking payo at opinyon upang makatulong sa pagresolba ng problema.

50. Tumalikod siya bigla saka pumasok sa kwarto niya.

Similar Words

capitalist

Recent Searches

infectiousreachcapitalselebrasyonresearchpedromeetnowcommunitysabihingtelangjeromepasangcebusorryhumanospetsasinagotisladevicescountriesthroughouttripauditkinukuyomlibingpacetermshouldhellopinilinggrabeprogrammingipinalitleadfallpowerpointhilingmagpagupitdahilperoatensyoncarenakaratinghumahangospasyapagsasayapagoddietsakityungmahiwagangkongathenanauntogsusnagmungkahiumiyakhalamananiwanpumupuntabalikbobopumitasnakagagamotnapagtantochecksupuanusasofaayonsmilemuchosiyopanunuksoobra-maestrakumantacellphoneyannakakapamasyalayospagsumamomakakakaingumigisingikinalulungkotpagtiisanmagkaibiganhinagud-hagodmagkakagustotime,dagat-dagatanpicsmakipagtagisanmagworknananalongpinakidalalalakimaipagmamalakingpaki-chargebiologirevolutioneretumagawpinigilannapasubsobpagkuwanprodujotinakasanhalu-halomaghintaykinakabahannababalotpaninigasregulering,automatiskmaghaponhouseholdtinungokangkonginiisipika-50industriyaafternoonipinauutangkesominatamispaakyatpulgadacantidadnapadpadadvancementniyogpagmasdanyumanigdilimmanggatypewikangipingkenjinapadaanarabiamahigpitengkantadamatangkadnetflixkalawangingtibigejecutanmagnifyarkilayorksinakopdiretsomanuelawitilocosroselle1950spigingiconskumalassagapnaglabanan1954supilinbigyanmembersnasunogmakahingianywherefrescopieceslapitanlingidmorenamakaratinginantaybinatangnakabawijunjunmaputimalapitbakeupworkreducedkiloipinagbilingpollutionmainitartsaccedermemobisigmodernpitoitongnilimasngusodahilanilan