Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "years"

1. 5 years? naramdaman ko yung pag iling niya, 1 year..?

2. All these years, I have been blessed with experiences that have shaped me into the person I am today.

3. All these years, I have been blessed with the love and support of my family and friends.

4. All these years, I have been building a life that I am proud of.

5. All these years, I have been chasing my passions and following my heart.

6. All these years, I have been cherishing the relationships and connections that matter most to me.

7. All these years, I have been creating memories that will last a lifetime.

8. All these years, I have been discovering who I am and who I want to be.

9. All these years, I have been grateful for the journey and excited for what the future holds.

10. All these years, I have been grateful for the opportunities that have come my way.

11. All these years, I have been inspired by the resilience and strength of those around me.

12. All these years, I have been learning and growing as a person.

13. All these years, I have been learning to appreciate the present moment and not take life for granted.

14. All these years, I have been making mistakes and learning from them.

15. All these years, I have been overcoming challenges and obstacles to reach my goals.

16. All these years, I have been reminded of the importance of love, kindness, and compassion.

17. All these years, I have been striving to be the best version of myself.

18. All these years, I have been striving to live a life of purpose and meaning.

19. All these years, I have been surrounded by people who believe in me.

20. All these years, I have been working hard to achieve my dreams.

21. All these years, I have been working to make a positive impact on the world.

22. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

23. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

24. Congress are elected every two years in a process known as a midterm election

25. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

26. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

27. He has been practicing yoga for years.

28. I finally quit smoking after 30 years - better late than never.

29. In recent years, television technology has continued to evolve and improve

30. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

31. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

32. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

33. In the years following his death, Presley's legacy has continued to grow

34. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

35. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

36. One of the most significant areas of technological advancement in recent years has been in the field of communications

37. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

38. She has been making jewelry for years.

39. She has been teaching English for five years.

40. She has been tutoring students for years.

41. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

42. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

43. The company's CEO announced plans to acquire more assets in the coming years.

44. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

45. The concept of money has been around for thousands of years and has evolved over time.

46. The President is elected every four years through a process known as the presidential election

47. They have lived in this city for five years.

48. They have studied English for five years.

49. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

50. We have been married for ten years.

51. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

52. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

53. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

Random Sentences

1. Maraming bagong laruan sina Justin at Andre.

2. The website's loading speed is fast, which improves user experience and reduces bounce rates.

3. Ang sarap kumain sa labas presko ang hangin.

4. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

5. The traffic signal turned green, but the car in front of me didn't move.

6. She is not playing the guitar this afternoon.

7. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

8. Pwede ba kitang tulungan?

9. When we read books, we have to use our intelligence and imagination.

10. Napangiti na lang ang binata at sumama sa dalaga, simula ng araw na iyon ay lagi na silang nagkikita.

11. Napadungaw ang ina at kitang-kita niya ang pagkasubasob ng anak bago paman ito nakaakyat ng hagdan.

12. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

13. Hindi dapat natin pigilan ang ating mga pangarap, kundi pagsikapan nating tuparin ang mga ito.

14. The President is elected every four years through a process known as the presidential election

15. Mahirap magpapayat kapag mahilig ka sa pulotgata dahil ito ay sobrang tamis.

16. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

17. Gumagalaw-galaw ang sabog na labi ni Ogor.

18. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

19. Sa bawat pagkakataon na binibigyan tayo ng pagkakataon, dapat nating gamitin ito nang wasto, samakatuwid.

20. Ang kaniyang pagsasalaysay ay animo'y isang makulay na kuwento mula sa isang librong mahirap kalimutan.

21. Kontrata? halos pasigaw kong tanong.

22. We celebrated their promotion with a champagne toast and a slice of cake.

23. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

24. Sa bawat pagkakataon na pinagmamalupitan ako, lumalaki ang poot sa aking puso.

25. Would you like a slice of cake?

26. Nakatayo ang aking guro sa harapan ng silid-aralan upang ipakita ang kanyang mga visual aids.

27. Lumayo siya sa amin, waring nais niyang mapag-isa.

28. Tumayo tayo para awitin ang Pambansang Awit.

29. Sya ngayon ay isa nang ganap na doktor.

30. Anong oras sila umalis sa Camp Crame?

31. Después de hacer ejercicio, me gusta darme una ducha caliente.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

34. Eksport af tøj og beklædningsgenstande fra Danmark er også stigende.

35. At forfølge vores drømme kan kræve mod og beslutsomhed.

36. Haha! Bad mood na bad mood ka ah?

37. Kaninang umaga ay bumigay na ng tuluyan ang kanyang katawan, wala ng nagawa ang mga doktor.

38. Siguro ay may kotse ka na ngayon.

39. Binulabog ng malakas na tunog ang katahimikan ng paligid.

40. Halatang takot na takot na sya.

41. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

42. Ang tubig-ulan ay nagbibigay ng mga oportunidad para sa mga aktibidad tulad ng paglalaro sa ulan, pagsusurfing, at iba pa.

43. Tanghali na nang siya ay umuwi.

44. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

45. Ako ay nagtatanim ng mga orchids sa aking mga paso.

46. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

47. Pumunta kami sa may bar ng bahay nila.

48. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

49. Nagulat ako nang biglaan siyang tumawag at nangumusta sa akin.

50. Ang mga estudyante ay sumailalim sa isang pagpupulong upang magbahagi ng kanilang mga mungkahi sa paaralan.

Recent Searches

yearsproducererstarsnatitiyakjandiyaryomakapangyarihangpakanta-kantauniquelalakengwaiterkunenagpapakainlilygongplayedautomatiseremakabilibawaltabing-dagattinangkalaganapmisusedmapa,sumingitlalongnakasalubongmatchingsectionsamangbowlsultanworkdalawampurawmapuputiumagangpanunuksotilanakapasamag-inamakebunsoinutusanisasabadcompositoresmayadoonnag-aralsalaminibatanggalinsansumalakayinatakekasamanapatawagtumalikodparanyatapathinogbiologitypesbasanatinbokanidilimkilalang-kilalauugod-ugodninyongdamitimbesbuskainbinibinipapapuntanaalalaginamitpataypagbubuhatanabangannalangtinawagitinaaseducativaskinagalitannakihalubilonayonsawatinanggalnagsasanggangsalbahengtungkodnakataaspagtinginmayamayavaccinesmamayangislandinilagaykailanmanwaringkabilismessagemakapalpinag-aaralanpare-parehosentencephilanthropymorearabiabasurakara-karakanag-bookrindawtanawintawagpaulpumitasmovingtungkolmaawatelefonerkuwartongpaladreserbasyonkukuhaguhitsisternagcurveaspirationpitumponglongkatagaawaysinomakangitinearasawapagkakahawaknakatanggapmagtatakabegankwebanginternetpiyanonagsmilekawili-wilibilhanelenaneedmag-isahinawakanassociationtinderabodasaringoutlineevolvestylesthoughtsnasundoomgbakitganyansustog,nakaratingpagkakamaliencompasseslisensyanagtalunanbundokatinmilyongcomfortcreatepagluluksajunebroadcastmakapanglamanghiningananahimiknami-misskagyatkamakalawageologi,presidentialspendingkaraokeexpertisemakahingidumikitlugarmatikmansumakaysumubo