Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

53 sentences found for "years"

1. 5 years? naramdaman ko yung pag iling niya, 1 year..?

2. All these years, I have been blessed with experiences that have shaped me into the person I am today.

3. All these years, I have been blessed with the love and support of my family and friends.

4. All these years, I have been building a life that I am proud of.

5. All these years, I have been chasing my passions and following my heart.

6. All these years, I have been cherishing the relationships and connections that matter most to me.

7. All these years, I have been creating memories that will last a lifetime.

8. All these years, I have been discovering who I am and who I want to be.

9. All these years, I have been grateful for the journey and excited for what the future holds.

10. All these years, I have been grateful for the opportunities that have come my way.

11. All these years, I have been inspired by the resilience and strength of those around me.

12. All these years, I have been learning and growing as a person.

13. All these years, I have been learning to appreciate the present moment and not take life for granted.

14. All these years, I have been making mistakes and learning from them.

15. All these years, I have been overcoming challenges and obstacles to reach my goals.

16. All these years, I have been reminded of the importance of love, kindness, and compassion.

17. All these years, I have been striving to be the best version of myself.

18. All these years, I have been striving to live a life of purpose and meaning.

19. All these years, I have been surrounded by people who believe in me.

20. All these years, I have been working hard to achieve my dreams.

21. All these years, I have been working to make a positive impact on the world.

22. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

23. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

24. Congress are elected every two years in a process known as a midterm election

25. Einstein was a member of the Institute for Advanced Study at Princeton University for many years.

26. Facebook Memories feature reminds users of posts, photos, and milestones from previous years.

27. He has been practicing yoga for years.

28. I finally quit smoking after 30 years - better late than never.

29. In recent years, television technology has continued to evolve and improve

30. In recent years, the Lakers have regained their competitive edge, with the acquisition of star players like LeBron James and Anthony Davis.

31. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

32. In the last three hundred years, many human efforts have been spent in search of sources of energy-coal, petroleum, and power generated from water which will maintain the present rhythm of civilization unchecked

33. In the years following his death, Presley's legacy has continued to grow

34. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

35. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

36. One of the most significant areas of technological advancement in recent years has been in the field of communications

37. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

38. She has been making jewelry for years.

39. She has been teaching English for five years.

40. She has been tutoring students for years.

41. Sinakop ng mga espanyol ang Pilipinas nang mahigit sa 300 years.

42. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

43. The company's CEO announced plans to acquire more assets in the coming years.

44. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

45. The concept of money has been around for thousands of years and has evolved over time.

46. The President is elected every four years through a process known as the presidential election

47. They have lived in this city for five years.

48. They have studied English for five years.

49. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

50. We have been married for ten years.

51. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

52. Women have been elected to political office in increasing numbers in recent years, though still underrepresented in many countries.

53. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

Random Sentences

1. Les archéologues utilisent la science pour comprendre les cultures du passé.

2. His presidency was marked by controversy and a polarizing political climate.

3. Thank God you're OK! bulalas ko.

4. Es importante mantener las heridas cubiertas y protegidas de la suciedad y los agentes irritantes.

5. If you think he'll lend you money, you're barking up the wrong tree.

6. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

7. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

8. May mga espesyal na pagdiriwang tuwing Linggo sa aming komunidad malapit sa karagatan.

9. Påskepyntning med farverige blomster og påskeharer er en tradition i mange danske hjem.

10. Matuto kang magtipid.

11. The children do not misbehave in class.

12. Amazon's Kindle e-reader is a popular device for reading e-books.

13. Ano ho ang nararamdaman niyo?

14. Ako. Basta babayaran kita tapos!

15. Proud ako sa kultura at tradisyon ng mga Pinoy.

16. Nationalism can also lead to a sense of superiority over other nations and peoples.

17. Pakiramdam ko ngayon ay puno ng inis dahil sa ginawa mo.

18. Ano ang kulay ng paalis nang bus?

19. Huwag kang pumasok sa klase!

20. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

21. Oscilloscopes have various controls, such as vertical and horizontal scaling, timebase adjustments, and trigger settings.

22. Kung maka-yo 'tong next partner ko kala mo taga kanto.

23. I hate it when people beat around the bush instead of just getting to the point.

24. Ang nagbabago ay nag-iimprove.

25. La visualisation et la réflexion sur ses réussites passées peuvent également aider à maintenir la motivation.

26. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

27. Human trafficking is a grave crime that needs immediate action worldwide.

28. Hindi makapaniwala ang lahat.

29. Ang agam-agam ay maaaring maging hadlang sa pagpapasiya at pagkilos ng tao.

30. Albert Einstein was a theoretical physicist who is widely considered one of the most influential scientists of the 20th century.

31. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

32. Gado-gado adalah salad sayuran yang dicampur dengan bumbu kacang yang kaya rasa.

33. The acquired assets included several patents and trademarks.

34. Habang naglalakad ako sa dalampasigan, natatanaw ko ang malalaking alon na dumadampi sa baybayin.

35. Los héroes están dispuestos a enfrentar los desafíos y luchar por lo que creen.

36. Ang kanta ay isinulat ukol kay Alice na kaniyang sinisinta

37. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

38. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

39. Ngayon ko pa lamang nakita ang halaman na ganito.

40. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

41. Ilan ang tiya mo na nasa Amerika?

42. Wait lang ha, sasagutin ko na baka importante eh.

43. Gaano ka kadalas nag-eehersisyo?

44. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

45. Hindi na niya kaya ang mabibigat na gawain dahil mababa ang kanyang lakas.

46. We need to optimize our website for mobile devices to improve user experience.

47. If you're expecting a quick solution to a complex problem, you're barking up the wrong tree.

48. Ang editor ay nagsusulat ng mga komento at mga pagsusuri sa mga akda ng mga manunulat.

49. They have organized a charity event.

50. Tila nagiging mas mahirap ang hamon habang tumatagal.

Recent Searches

yearspshmalinismaalogremaincomienzanprovidepyestaexperiencestransparentgracelangginisingcongratsnakaliliyongpossibleimpitmaputipracticadocigarettelastinglibreboxworkknowledgeprogramming1982internalayanpasinghaleffectmanuksolumalakinapatigninpinakainnalalamannagmamadalinathanmalayongpinapatapospataysaidshortmagsunoglumibotdavaofotosmanggaimbesbahay-bahaysorekulisapetomaglalabapaiddilimpublishedvariousbabasahinchinesewatchagafullvalleynarinigpanindaiilanpinakamagalingnageenglishgeologi,nanghihinamadmakapangyarihansalu-salomurang-murapinakamaartenggayunpamannag-away-awaybalepanghabambuhaymeriendamakatatlonagpaiyakpulang-pulanakakabangonmakikiraanreserbasyonmumuratinatawagnanlilimahidhealthiermarketplacesunahinmagpagalingdumagundongpagkapasokpaghihingalonag-angatnapapasayatatawaganpinahalatanagpatuloyhitsuracultivanakaimbaktitanakabawipandidiritumakashampaslupanagpagupitpaglakipagtataasmakakakaennanlakinasiyahaniwinasiwasmagkapatidinsektongtrabahonagbibirodropshipping,pakikipaglabanpeksmantutoringmagdamagpagkuwansumusulatmagkasabaylalabhandispositivonakasakitpagkaraatelecomunicacionesmagawadiferentespantalonbalikatgagamitattorneykatolisismosuzettenaglaonsignalrodonahistoryginawaranumigibligaligpagsidlanunoshunimisyunerongaayusinfreedomsitinaasumulannatalotiemposnaghubadtuyolakingpracticespublicityyork1960sgigisingsmilesakimestatemaongpokergulangpinaulanankinanochesikipdespuesgardencarmentambayanfitdibaelectoralnatagalanlagunatokyoasiaticlistahannasaninfluencesbagkuspunong-punoarbejdsstyrkekungwashingtonzoomaskilifealamidpakealam