Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "huwebes"

1. Libre ba si Renato sa Huwebes ng gabi?

Random Sentences

1. They are a great way to use up leftover ingredients and reduce food waste.

2. Zachary Taylor, the twelfth president of the United States, served from 1849 to 1850 and died while in office.

3. Nagbakasyon kami sa tabi ng karagatan noong tag-init.

4. Matumal ang bentahan ng bulaklak ngayong lockdown.

5. El té verde se elabora con las hojas de una planta de hierbas llamada Camellia sinensis.

6. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

7. Ang mga opisyal ng barangay ay nag-organisa ng programa kung saan ang mga residente ay maaaring lumibot sa kalsada para sa pagsasanay sa kalusugan.

8. La paciencia es necesaria para tomar decisiones importantes.

9. Popular fillings for omelettes include cheese, ham, vegetables, mushrooms, and herbs.

10. The feeling of accomplishment after completing a difficult task can be euphoric.

11. Nakangiti sya habang nakatayo ako at nagtataka.

12. Nagpasensiya na lang si Aling Rosa, napagsilbihan naman siya kahit paano ng anak.

13. Kailan niya kailangan ang kuwarto?

14. He is not running in the park.

15. Ang payat at namumutla ang dalaga kaya nag-alala ang binata.

16. He has learned a new language.

17. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

18. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

19. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

20. Nakita ko namang natawa yung tindera.

21. The business started to gain momentum after a successful marketing campaign.

22. Elektroniske apparater kan hjælpe med at forbedre kommunikation og forbindelse med andre mennesker.

23. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

24. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

25. Helte kan have en positiv indflydelse på hele samfundet.

26. The cuisine in Los Angeles reflects its diverse population, offering a wide range of international and fusion culinary experiences.

27. Some oscilloscopes have built-in signal generators for testing and calibration purposes.

28. Work can be challenging and stressful at times, but can also be rewarding.

29. The patient was advised to reduce salt intake, which can contribute to high blood pressure.

30. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

31. We should have painted the house last year, but better late than never.

32. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

33. Happy birthday to my best friend, I hope you have a wonderful day!

34. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

35. Tinamaan ng lumilipad na bola ang bintana at ito’y nabasag.

36. The presentation was absolutely flawless; you did a great job.

37. Maramot ang kapitbahay nila at hindi nagpapahiram ng gamit kahit kailan.

38. Hindi maikakaila, mas malakas ang pamilyang magkakasama.

39. Nationalism can also lead to a sense of superiority over other nations and peoples.

40. Hindi dapat natin pahintulutan ang paglapastangan sa karapatan ng mga mahihina at marhinalisadong sektor ng lipunan.

41. Hindi ako sang-ayon sa mga pahayag ng ilang mga personalidad sa social media.

42. Basta may tutubuin ako, lahat ay areglado.

43. Siya ay apatnapu't limang taong gulang at nakapangasawa sa isa sa mga magaling tumugtog ng piyano

44. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

45. Las labradoras son conocidas por su energía y su amor por el agua.

46. Forgiveness is an act of liberation, allowing us to reclaim our power and live our lives free from the burden of past hurts.

47. Bagaimanakah kabarmu hari ini? (How are you today?)

48. The team's performance was absolutely outstanding.

49. Du behøver ikke at skynde dig så meget. Vi har masser af tid. (You don't need to hurry so much. We have plenty of time.)

50. They are not cooking together tonight.

Recent Searches

revolutionizedhuwebesinvitationpasensyaninongumaagosnaiinitanpublicationtrajelarongrenatoingatanipapaputoltapatnagbasagene1920spaghingiinantaycassandrasentencekalakingmaalogcryptocurrencybumahaseekdalawsaanmalagoteleviewingpinyaspentbuwankatapattransportmaubosgamesngpuntalackditoalinglabingjackzgabepocaadditionhimigcontinuedlightsitinuringbadingrestferrergawinresponsibleeyeetoataquesshiftclassesexplainwhetherpatrickipinalutocontrolledscalemakestechnologiesimprovedotrovirksomhedernanaogmalamigkinadulocampaignsimikfulfillmentklasemataassakopnaka-smirknapadungawkamakalawawednesdaynagsisilbibuhoknanooditaasislamadetinderanapatinginmaramimorninglangmasyadongrelievednapakatagalmakalaglag-pantynegosyomasimbeschumochosbooksemphasisbangladeshpumapasokbasketballmayabongnglalababatangkomunikasyonpinakamaartengpagsumamosimbahanrevolucionadokaaya-ayangmagasawangkinatatakutannagmamaktolendingnagpagupitmakikikainhouseholdseconomysiniyasatinaabutannakatapatnag-poutkagandahanaraw-tumakaskwartonalamaninjurynabighanimahiwagapakakatandaanpinapalonagtalagaenterpoorerpamagatnasaananyopasyentenaghihirapkamandagnakabibingingkulungankinumutanmaluwagsubject,pumikitsinisiracompanieshagdananpaligsahanpalasyosampaguitarenaiakatagangperseverance,anunguniversitiesmasungitebidensyamandirigmanghatinggabirabeprosesoestateanghelsumpainnilalangangkopipagmalaakidiseasealmacenarkumaripaspepeparibangkomagkasinggandakingdombiligivernamakuyabagyosilbingpiecesgatheringbairdbilaotransmitsmakasarilingbasahanerap