Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "see"

1. Bis bald! - See you soon!

2. Bis morgen! - See you tomorrow!

3. Bis später! - See you later!

4. Haha! I'd want to see you fall inlove tonight.

5. He could not see which way to go

6. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

7. I just launched my new website, and I'm excited to see how it performs.

8. I'm sorry, I didn't see your name tag. May I know your name?

9. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

10. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

11. Necesito ver a un médico. (I need to see a doctor.)

12. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

13. Sampai jumpa nanti. - See you later.

14. See you later. aniya saka humalik sa noo ko.

15. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

16. There?s a world out there that we should see

17. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

18. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

19. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

20. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

21. Users can follow other accounts to see their tweets in their timeline.

22. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

Random Sentences

1. At blive kvinde kræver også mod og selvstændighed.

2. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

3. Who are you calling chickenpox huh?

4. Boboto ako sa darating na halalan.

5. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

6. It's complicated. sagot niya.

7. Maasim ba o matamis ang mangga?

8. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

9. Frustration can be caused by external factors such as obstacles or difficulties, or by internal factors such as lack of skills or motivation.

10. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

11. All is fair in love and war.

12. Marahil anila ay ito si Ranay.

13. If you want to get ahead in your career, you have to put in the extra hours - the early bird gets the worm.

14. The conference brings together a variety of professionals from different industries.

15. Bis später! - See you later!

16. Investors with a higher risk tolerance may be more comfortable investing in higher-risk investments with the potential for higher returns.

17. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

18. Nahanap niya ang nawawalang susi sa ilalim ng tarangkahan ng kotse.

19. Noong kabuntisan ng kanyang ina sa kapatid niyang bunso ay iniwan ito ng asawa.

20. Ganun ba talaga kalaki yung impact ng pananakot ko sa kanya?

21. Nakapagpropose ka na ba talaga? pagtatanong ko.

22. Drømme kan være en kilde til inspiration og kreativitet.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. Inakalang nanalo siya sa laro, pero may mas mataas pa palang puntos ang kalaban.

25. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

26. She is drawing a picture.

27. Kailangan mo ng matapang na puso upang lumaban sa agaw-buhay na mundo ng negosyo.

28. Bayaan mo na nga sila.

29.

30. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

31. Nag-aaral siya sa Seasite bawat araw.

32. Walang sinumang nakakaalam, sagot ng matanda.

33. Ang pasaway na estudyante ay na-suway nang paulit-ulit ng kanyang guro.

34. Ano ang pinapakinggan mo sa radyo?

35. Eine Inflation kann die wirtschaftliche Ungleichheit verschärfen, da Menschen mit niedrigerem Einkommen möglicherweise nicht in der Lage sind, mit den steigenden Preisen Schritt zu halten.

36. Binigyan niya ako ng isang dosenang rosas.

37. Nag-email na ako sayo kanina.

38. Ang pagpapa-tanggal ng ngipin ay ginagawa kapag hindi na maaring malunasan ang sira nito.

39.

40. Lumakad ako nang mag-isa sa madilim na daan at nagitla ako nang biglang may humawak sa aking balikat.

41. I have lost my phone again.

42. Bakit kayo nagtungo sa Mendiola?

43. La música clásica tiene una belleza sublime que trasciende el tiempo.

44. Kuripot daw ang mga intsik.

45. The stock market can be influenced by global events and news that impact multiple sectors and industries.

46. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

47. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

48. Nangangaral na naman.

49. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

50. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

Similar Words

seenSeek

Recent Searches

seestageceslastsaringjustprodujotrueputicigarettesusedinterpretingipinagbilingdidingmarumisutiltabicreationsorpresabathalainfluenceestasyoncleanblesstelevisedlikelyroboticwritesameeitherinformedmitigateincreasesayandraft,internapansamantalamagpapagupitpalaisipanmarketinginakyatsumasaliwakmangbiyasalakmungkahibagalvivapeppydailytactomejomadurasmagtatakaseriouslawsbisikletahearbillknow-howdatiunanbilaobakatinikjuicesamaano-anoadventnakakatawakinikitakinamumuhianthirdmalayonapakamisteryosoipinadakipipinanganakestékumalantogkeepingmagsayangeffortsnagmungkahipresidentialobserverermakahiramkaloobangkapatawarannaabutangapkapilingnasaangmangingisdabrancher,strategiespagkababamakatatlokarwahenghinimas-himaskaguluhannakapagproposetonycometilastokanginaminatamisnasasalinanmagtagosandwichvitamingubatsittingtinigilanstreetnahantadkambingtulanghimayinmakulitmaninipisdistansyanapakagandamakikipag-duetotakotareassumuotdumaanpangalannaging1787nasabingcineblusangfeltcharmingrabereadersnakasahodpumilicallbinabatuwidpaslitdingdingcorrectingventaflypigingkasaganaanagadkumulogcertainmedialivesadvertising,gabi-gabinatanongnapatawaginspirasyonnakahugnakatagotalentnaiyakmakipag-barkadaeskwelahanbatomaghaponmakauwimilyongstaynakakamanghaitinaasnatayostarted:rememberedtibigbihirangnananaginipmadalimagisingbinanggasupilinnarinigiyanpasalamatanbigyangoalhiningisalamorenaattentionspansahitmaydireksyonsystematisksantocanadanapansin