Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "see"

1. Bis bald! - See you soon!

2. Bis morgen! - See you tomorrow!

3. Bis später! - See you later!

4. Haha! I'd want to see you fall inlove tonight.

5. He could not see which way to go

6. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

7. I just launched my new website, and I'm excited to see how it performs.

8. I'm sorry, I didn't see your name tag. May I know your name?

9. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

10. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

11. Necesito ver a un médico. (I need to see a doctor.)

12. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

13. Sampai jumpa nanti. - See you later.

14. See you later. aniya saka humalik sa noo ko.

15. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

16. There?s a world out there that we should see

17. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

18. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

19. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

20. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

21. Users can follow other accounts to see their tweets in their timeline.

22. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

Random Sentences

1. Football players wear special equipment such as shin guards to protect themselves from injury.

2. Magtaka ka na kung hindi pa sya umuuwi bukas.

3. En España, la música tiene una rica historia y diversidad

4. Ang mga bayani ay nagpapakita ng malasakit at pagmamalasakit sa kapwa tao.

5. También cuentan con pantallas táctiles y una gran cantidad de memoria interna para almacenar información, fotos, videos y música

6. Naging bahagi ang mga kanta ng Bukas Palad sa aking proseso ng pagsasanay sa pagtugtog ng gitara.

7. Tantanan mo ako sa legend legend na yan! hahaha!

8. The lightweight construction of the bicycle made it ideal for racing.

9. She does not use her phone while driving.

10. Ayoko pong nakakulong sa madilim na lugar na kinalalagyan ko.

11. In 2010, LeBron made a highly publicized move to the Miami Heat in a televised event called "The Decision."

12. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

13. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

14. Linggo ng umaga at ang palengke ay siksikan.

15. Les maladies cardiaques, le cancer et le diabète sont des problèmes de santé courants dans de nombreux pays.

16. Bago pa man napigilan ng bata ang babae ay naisubo na nito ang puting laman ng bunga.

17. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

18. Ibinigay ng titser ang libro sa estudyante.

19. Some fathers struggle with issues such as addiction, mental illness, or absentia, which can negatively affect their families and relationships.

20. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

21. There were a lot of people at the concert last night.

22. At sa kanyang maninipis na labi, na bahagyang pasok sa pagkakalapat at maputla, ay naglalaro ang isang ngiti ng kasiyahan.

23. Kumaliwa ka sa susunod na kanto.

24. Le chien est très mignon.

25. Wag mo ng pag-isipan, dapat pumunta ko.

26. Nasi padang adalah hidangan khas Sumatera Barat yang terdiri dari nasi putih dengan lauk yang bervariasi.

27. Seperti makan buah simalakama.

28. El arte es una forma de expresión humana.

29. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

30. Anong award ang pinanalunan ni Peter?

31. Bilang paglilinaw, ang proyekto ay hindi kanselado kundi ipinagpaliban lamang.

32. Sa wakas, nangahas siyang sundin ang kanyang pangarap, anuman ang mga balakid na nasa kanyang harapan.

33. Ang bakuna ay lubos na nakakatulong kontra sakit.

34. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

35. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

36. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

37. Les travailleurs peuvent obtenir des avantages supplémentaires tels que des bonus ou des primes pour leur excellent travail.

38. Kucing dikenal dengan sifatnya yang lucu, manja, dan lincah.

39. Sa pulong ng mga mag-aaral, ipinahayag nila ang kanilang mga mungkahi upang mapabuti ang pasilidad ng paaralan.

40. Más sabe el diablo por viejo que por diablo. - Age and experience trump youth and cleverness.

41. Ang masasakit na salitang binitiwan nya ay lubos na nakasakit sa kanyang ina.

42. The momentum of the rocket propelled it into space.

43. The experience of bungee jumping was both terrifying and euphoric.

44. Nagpunta ako sa Hawaii.

45. Users can save posts they like or want to revisit later by using the bookmark feature on Instagram.

46. Certaines personnes sont prêtes à tout pour obtenir de l'argent.

47. Nang matanggap ko ang taos-pusong paghingi ng tawad, ang aking galit ay napawi at nagkaroon kami ng pagkakasunduan.

48. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

49. The actress on the red carpet was a beautiful lady in a stunning gown.

50. Kailangan ko ng lumisan mahal ko.

Similar Words

seenSeek

Recent Searches

seefuesancontent,loansheypasanyancoathallumiilinggalitresearch:roontryghedfakebringputieyeagilitydonmainitfindtuwidcomelaylaymalimitteachbeintesarilicontinuedhimig2001conditioningnasundooffentlighimselfchecksrelativelybehalfmobileexitgeneratedcurrentleadhatemanarawbinilingunconstitutionalcertainrememberconditionalignsplatformreleasedgotpakukuluankategori,gayunpamanmagsasalitakawili-wilinaiwankarwahengalas-diyesginugunitanakakitamaliwanagdisenyongaanhinmiyerkolesnagkasunogmakipag-barkadaselebrasyonnanlilisikmagkapatidiintayinnagawangunti-untinaabutanpagkagustopaanongnagpagupitpronounpagkalitomakasilongtoolsikukumparaihahatidmedisinapangyayaripagpanhikatensyongpagtawananunuksotumakaspinapataposlalakadinaaminnakakatabamagtiwalamagdilimgroceryparaangnaglulusakhinalungkatdagapatakboprovegospellagnatglobalpetsangmedyogodtbritishmamarilpatientrangejunjunthemactingtsaakinatatakutanagosnagtitindanaglalakadpoliticalnapatawagnakatuwaanglumalakipatutunguhanbangladeshmakauuwiapatnapunaglulutopagkainiskahulugannagpaalammanilbihankuwentokahonglalabasbalediktoryanuulaminsaan-saannakaakyatminatamisbasketbolkampeonnalugodiiwasannakitulognatabunanhabangplantassubject,pakibigyannagbibigayantsismosasiopaosinongitihonestonagbagotutusinasukalmaynilaawitancynthiasaktanrewardingpadalasniyogtumingalatanghalidumilatnakapikitescuelastinurogumisingitinaasgawinglisteningmaluwagpisaratanyagnakabaonkawalankaniyakapalplanning,maglabakainangustongbihasapanataglugawmaestrasanto