Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "see"

1. Bis bald! - See you soon!

2. Bis morgen! - See you tomorrow!

3. Bis später! - See you later!

4. Haha! I'd want to see you fall inlove tonight.

5. He could not see which way to go

6. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

7. I just launched my new website, and I'm excited to see how it performs.

8. I'm sorry, I didn't see your name tag. May I know your name?

9. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

10. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

11. Necesito ver a un médico. (I need to see a doctor.)

12. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

13. Sampai jumpa nanti. - See you later.

14. See you later. aniya saka humalik sa noo ko.

15. The act of forgiveness requires empathy and understanding, allowing us to see beyond someone's mistakes and recognize their humanity.

16. There?s a world out there that we should see

17. This allows people to see their leaders and candidates in action, and it also allows for a more transparent political process

18. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

19. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

20. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

21. Users can follow other accounts to see their tweets in their timeline.

22. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

Random Sentences

1. The lightweight construction of the bicycle made it ideal for racing.

2. Agaw eksena ang babaeng himihiyaw sa palengke.

3. Efter fødslen skal både mor og baby have grundig lægeundersøgelse for at sikre deres sundhed.

4. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

5. Ah talaga? Oo nga nuh, nung niyakap kita namula ka.

6. Ang hinagpis ng mga nawalan ng tahanan ay ramdam sa kanilang pananahimik.

7. Sa gitna ng pagkabigo, nagpalabas ako ng malalim na himutok upang maibsan ang sakit sa puso ko.

8. Women have shown remarkable resilience and strength in the face of adversity and oppression.

9. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

10. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

11. Di mo ba nakikita.

12. Nagpapakain ako ng aking aso sa hatinggabi bago kami pareho matulog.

13.

14. Dahil sa kagustuhang malaman ng mga kapatid ni Psyche ang hitsura ng asawa, tinanggal nila ang maskara nito at tumambad ang magandang mukha ni Cupid

15. Les maladies chroniques telles que l'asthme, l'arthrite et le syndrome de fatigue chronique peuvent affecter la qualité de vie d'une personne.

16. No hay mal que por bien no venga. - Every cloud has a silver lining.

17. Dedication is the fuel that keeps us motivated, focused, and committed to achieving our aspirations.

18. The symptoms of leukemia include fatigue, fever, and easy bruising or bleeding.

19. A couple of songs from the 80s played on the radio.

20. Pigain hanggang sa mawala ang pait

21. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

22. Pagkaraan ng ilang araw ay magaling-galing na si Aling Rosa.

23. The eggs are beaten until the yolks and whites are well combined.

24. Las personas pobres a menudo carecen de recursos para protegerse de desastres naturales y crisis.

25. The doctor prescribed antibiotics to treat the pneumonia.

26. Walang puno ang hindi hitik sa bunga.

27. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

28. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

29. Umiling ako. Hindi naman po. nakangiti ko pang sagot.

30. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

31. I have received a promotion.

32. Bakit lumilipad ang manananggal?

33. Amazon's customer service is known for being responsive and helpful.

34. Many fathers have to balance work responsibilities with family obligations, which can be challenging but rewarding.

35. Stocks and bonds are generally more liquid than real estate or other alternative investments.

36. Hun er utrolig smuk. (She is incredibly beautiful.)

37. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

38. I know I should have apologized sooner, but better late than never, right?

39. Bumili ako ng sarong. Ikaw, saan ka nagpunta?

40. Ang beach resort na ito ay hitik sa mga atraksyon tulad ng mga water sports at spa treatments.

41. Sapagkat matagal na ring sumasamba sa mga anito ang mga katutubo, hirap na hirap si Padre Novelles na manghikayat.

42. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

43. Samantala sa malamig na klima, nag-aalaga siya ng mga halaman sa loob ng bahay.

44. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

45. Pagapang na bumaba ng hagdanan ang anak, sa pagsayad ng mga kamay nito sa lupa ay unti-unti itong nagbago.

46. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

47. Twinkle, twinkle, little star.

48. The children do not misbehave in class.

49. Kung kaagaw ko ang lahat, may pag-asa bang makilala ka?

50. Marami pa siyang mga pangarap sa buhay at kailangan ko pa po siya.

Similar Words

seenSeek

Recent Searches

awarosacaretenderbayaningseelossbecomingmenoscomputere,sumarapwhiledoescreationmuchkitanotherhulingbitbitdoonderworkdaybehindnegativetuluy-tuloyromanticismolayuantrycycleworldtheykasintahannag-umpisamadekagipitannamangmatakottabing-dagattumatawadbinitiwanmalapalasyodialledpuntahanunoscompositoresmagtanimproudmini-helicopterpasigawdalagaiconicpapuntangjerryrangeexamplewalang-tiyaktelefonkapilingngunitdi-kalayuanfatheribigaylabordrewcountriesmeanlibrelastingpracticadomainitbeingbeginningpasokhanbilerenchantedfloorburdenimaginationngamallswakasdolyarprogramming,signalsiopaonakatuoncardigankulturnaglaonnapahintokatolisismoapelyidopinangalanangpumayagmabatonghinihintaynagwo-workpodcasts,nagliliyabnagpakitamagkakaanakmaglalakadtilmagpa-checkupnagmungkahianibersaryonagtatrabahoikinagagalaknakatitiginiindapanindamahiyatinayfilipinapagkainishoneymoonmagsugalmagbibiladnagbantaytravelstrategiestitapioneermangkukulambestfriendnagpakunotkulay-lumotyumabongmahawaanpagkapasoknaiyakminamahalpinapasayaenergy-coalunti-untikinagalitanpamburaisinulatmerlindabumibitiwe-commerce,tibokeleksyoninastabulongnakakapuntanabiglabatang-batajolibeewanthinanapbatanatutuwabanlagde-latanatalomaestralugawligayakastilasabongvitaminpiyanotumindigsarisaringrespektivepanginoonattorneyitinaobsuriinpaliparinmagisiptinanggalvictoriapublicitysisterpinatirabrasolalakekumbentoinimbitasurroundingsilagaybaryodisenyokutodnapakorememberedgigisingmagpa-ospitalbusymalayanglumulusobmaskiadoptedpulisnoondikyamwasteyari