Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "collections"

1. Ilalagay ko 'to sa mga action figure na collections ko.

2. The fashion designer showcased a series of collections, each with its own unique theme and style.

3. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

Random Sentences

1. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

2. Pumunta ka dito para magkita tayo.

3. Salamat ha. aniya bago ako makapasok sa kwarto.

4. Maaaring magdulot ng agam-agam ang mga suliraning pang-ekonomiya tulad ng kahirapan at pagtaas ng presyo ng mga bilihin.

5. Talaga ba Sharmaine?

6. They do not eat meat.

7. Sa kanyang paglalakad sa kahabaan ng dagat, napadungaw siya sa malalaking alon at namangha sa kanilang ganda.

8.

9. Risk tolerance is an important factor to consider when deciding how to invest.

10. The wedding rehearsal is a practice run for the wedding ceremony and reception.

11. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

12. Durante las vacaciones, nos reunimos alrededor de la mesa para compartir historias y risas con la familia.

13. The acquired assets have already started to generate revenue for the company.

14. Inakalang masama ang panahon, pero biglang sumikat ang araw.

15. Napatingin ako sa kanya, Bakit naman?

16. Sa ganang iyo, dapat bang palawigin pa ang curfew hours sa ating lungsod?

17. The garden boasts a variety of flowers, including roses and lilies.

18. Nawala yung antok ko. May pumasok na evil plan sa utak ko.

19. Kumusta ho ang pangangatawan niya?

20. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

21. Motion kan også have positive mentale sundhedsmæssige fordele, såsom at reducere stress og forbedre humør og selvværd.

22. Einstein's theory of general relativity revolutionized our understanding of gravity and space-time.

23. Ang kanyang presensya sa aming pagtitipon ay lubos naming ikinagagalak.

24. Inflation kann durch eine Zunahme der Geldmenge verursacht werden.

25. Some viruses, such as the common cold and flu, can cause mild symptoms, while others, like HIV and Ebola, can be deadly.

26. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

27. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

28. The new restaurant in town is absolutely worth trying.

29. The platform has also been criticized for promoting harmful content and contributing to online bullying.

30. Ano ang kulay ng paalis nang bus?

31. Einstein was a member of the NAACP and spoke out against racism in the United States.

32. Kahit siya ang nauna ay lagi siyang inuunahan ni Ogor sa pagsahod.

33. Napanood ko ang concert ng aking paboritong banda kaya masayang-masaya ako ngayon.

34. Ang mga halaman sa bukid ay natutuyo dahil sa matinding tagtuyot.

35. I used a traffic app to find the fastest route and avoid congestion.

36. Marami siyang ginawang pagkakamali sa proyekto, samakatuwid, hindi ito natapos sa takdang oras.

37. Many people think they can write a book, but good writers are not a dime a dozen.

38. Kailan libre si Carol sa Sabado?

39. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

40. Nakapagpropose ka na ba talaga? pagtatanong ko.

41. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

42. Omelettes are a popular choice for those following a low-carb or high-protein diet.

43. I'm going to surprise her with a homemade cake for our anniversary.

44. Bakit umiiling ka na naman? May problema ka ba?

45. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

46. The beauty store has a variety of skincare products, from cleansers to moisturizers.

47. Einstein's work has influenced many areas of modern science, including the development of string theory and the search for a theory of everything.

48. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

49. Umalis siya kamakalawa ng umaga.

50. La esperanza es lo que nos mantiene adelante en momentos difíciles. (Hope is what keeps us going in difficult times.)

Recent Searches

santoconsistfeltcollectionssaladedication,jackybaulayudaloripasyapshtenderfascinatingdoonvariouspersonsmainiteducationalfarpublishingrequirecertainstatingcleanbinabanegativeinfinitydifferentmangingibigbahay-bahayankumantadisyembresamantalangnapakagandangpansamantalateknologiheartbeatpaghahabimarasigannagpaiyakfranciscosumusunodgasolinanabighaninagtuturotilskrivesmaglalaropakibigaytelephonepagsisisinakaakyatlegendaryvitaminsnaiinitanpananakitminamahaltirahanknowledgewhiledistancestatlongmantikajacky---libertymagpakaramiautomatisksobrangbiglaantahimiknatakotnaantigpagtawagagambapaakyatpinapakiramdamanpinakamahalagangnogensindenakauslingvidtstraktparagraphsnagtutulaksagutinumiibigoperativosmagigitinghanapbuhaynaglabananmakikikainnagpuntangunittumangopasensyadi-kalayuanpalengkemendioladeletingflexiblemataasmagnifycongratslarongfeedback,mitigatemakapangyarihankaaya-ayangnakikini-kinitanagngangalangnanghihinamadkapangyarihangaumentarnagmamadaliglobalisasyonkagandahanpagpasensyahanmagasawangsalenagpipiknikpagsumamobarreraserhvervslivetpamburanahihiyangpagtangisinsektongopgaver,sakristanmakalipasestudyanteerlindamahiwagangencuestasdisfrutarkinasisindakanpagtatanimpagkagustoimporbumibitiwkanikanilangsunud-sunuransulingankanginasenadormaintindihansiksikanmaanghangkamandagumagawsumusulatprodujoumakbaydalawangpangitnangapatdanfysik,principaleslagaslasmagamotsay,jingjingbecomingberegningerhulihanfactorestrabahoeliteiniiroglumiitrobertemocionesxviifavorpaostumigilpagbibirosementeryomagkabilangpancitlaruanrenatoangkopjamestelangvoteswaiteranungmauboskaniyabayaningawitinkatibayangpalitanabigaelumibigcrecerunconstitutionalriegaknightpleasedepend