Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "convertidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Bagay na bagay kayong dalawa. Paano ba kayo nagkakilala?

2. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

3. Nagtatrabaho ako sa Mimosa Family Home.

4. Lumiwanag ang paligid dahil sa paputok.

5. When we read books, we have to use our intelligence and imagination.

6. The victim was able to identify the culprit who had been harassing them for months.

7. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

8. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

9. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

10. May tatlong kuwarto ang bahay namin.

11. Los océanos contienen la mayor cantidad de agua en la Tierra.

12. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

13. There are also concerns about the environmental impact of mobile phones, as the devices are often discarded after a short period of use

14. La paciencia es necesaria para superar las pruebas de la vida.

15. Huwag ka nanag magbibilad.

16. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

17. Kailangan na nya makuha ang resulta ng medical exam bukas.

18. Durante las vacaciones, a menudo visitamos a parientes que viven lejos.

19. Ganyan talaga ang buhay lagi kang nasasabihan.

20. En invierno, los lagos y ríos pueden congelarse, permitiendo actividades como el patinaje sobre hielo.

21. Espresso is a concentrated form of coffee that is made by forcing hot water through finely ground coffee beans.

22. Naglaro ako ng soccer noong Oktubre.

23. Pinuntahan ng pasyente ang doktor.

24. Selain sholat, orang Indonesia juga melakukan doa melalui upacara adat dan keagamaan.

25. At hanggang ngayon nga ay pinatutunayan pa rin ng mga aso na sila ay tapat sa kanilang mga amo.

26. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

27. Naisip ko ang aking dating kasintahan, datapwat alam kong masaya na siya sa kanyang bagong relasyon.

28. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

29. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

30. Ang talakayan ay ukol kay Dr. Jose Rizal at sa kanyang mga kontribusyon sa bansa.

31. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

32. Bayaan mo na nga sila.

33. Pinagalitan niya ang matanda at tinulak-tulak ito.

34. Mi aspiración es trabajar en una organización sin fines de lucro para ayudar a las personas necesitadas. (My aspiration is to work for a non-profit organization to help those in need.)

35. Today, Bruce Lee's legacy continues to be felt around the world

36. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

37. Dedication to personal growth involves continuous learning and self-improvement.

38. Mathematics is an essential tool for understanding and shaping the world around us.

39. Ang laki ng wedding cake na ginawa ng kanyang ate.

40. Mahilig siya sa pagluluto, datapwat madalas ay hindi niya nasusunod ang tamang recipe.

41. Kumain kana ba?

42. Medyo napalakas ang pag kakauntog nya sa pader.

43. Kakain ako ng spaghetti mamayang gabi.

44. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

45. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

46. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

47. Durante el invierno, es importante tener un buen sistema de calefacción en el hogar para mantenerse caliente.

48. Después de la clase de yoga, me siento relajada y renovada.

49. Me siento cansado/a. (I feel tired.)

50. Sigurado na siyang walang panalo sa kanya ang matanda.

Recent Searches

convertidasadventkasinggandasedentaryincreasinglydaigdigdragonipasokpangulopedeconventionalrestawanstatuslangkayalas-dosealas-dosmalakinglikelyendarmedbowtiyatheredollaraddpersonswaysasulstringitemssequeedit:interactinaapitechnologiesconditionrobertconstitutionfourisipannananaloretirartinderaangheljocelynlargelumakingtabingcongratsmakisignapadungawsulyapmantikanagdabogconstantlybighanieditpagtatakakarnabalresumenmagsi-skiingmakauuwinahulogbaonapamakikipagbabagplantasmightpinag-aralandilagsentimosgiraysafermakikikainoutlinesingeribabanaroonprivatefansmapakaliimportanttwinklebornumigtadnagkakatipun-tiponagwadornakaramdamnanghahapdimagkasintahansundhedspleje,upuankatawangnagtagisannakumbinsipagpasensyahannagpipiknikpapagalitansabadongnalalabiiphonemahihirapkahariankabundukankumakapalpinabayaanpaglalabadaiwinasiwasnasisiyahanmatalinonakatapatbumahaninanaispaglapastanganexhaustionmahahalikpambatangmagpagupitmagturokumikilosmedisinadistanciaharapanenviarisinagotnakahainyumabanglumibotpamumunoiniindabumaligtadpaulit-ulitkristojosiehonestolungsodkuripotpaninigaspakukuluanhiniritnahahalinhankawawangchristmasginoongibabawinhalelever,valiosapalantandaansasapakinumaasahastayoutubeisinumpaasawanapapatinginnapilitangrequierenmawalaipinansasahogahastssstinikiniibiguntimelyantoksisidlantulalamakinangtatawaganknowsiconicpriestpepeparangeducationinatakemalumbaybuenaangkancomputerdietnoopinatidmario00amtapattumangobarrocotinanggaphalalanpakelamcommissionspeechesaywannagdaramdamginangkerbbroadcastboss