Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "convertidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

2. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

3. I saw a pretty lady at the restaurant last night, but I was too shy to talk to her.

4. La música puede ser una forma de protesta y expresión de descontento.

5. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

6. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

7. Les enseignants peuvent être amenés à enseigner dans des écoles différentes en fonction de leurs besoins professionnels.

8. Ang pagdating ng mahigpit na bagyo ay nagdulot ng malalakas na alon at binulabog ang mga bayan sa tabing-dagat.

9. The United States has a system of checks and balances, where each branch of government has the power to limit the power of the other branches

10. Unrealistic expectations can contribute to feelings of frustration and disappointment.

11. Magkano ito?

12. The singer on stage was a beautiful lady with an incredible voice.

13. Imbes na gamitin ang pana para kay Psyche, ay pinabayaan niya lamang itong mamuhay ng normal at tumaliwas sa utos ng ina.

14. Hindi importante kung maganda o pangit ang itsura, ang mahalaga ay hindi kababawan ng kalooban.

15. The store offers a variety of products to suit different needs and preferences.

16. Las hojas de mi cuaderno están llenas de garabatos y notas.

17.

18. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

19. Read books on writing and publishing, it will help you to gain knowledge on the process and best practices

20. Simula noon ang batang si Amba ay naging unang gagamba.

21. Ito lang naman ang mga nakalagay sa listahan:

22. Kailangan nating magfocus sa mga bagay na may kabuluhan at hindi sa kababawang mga bagay sa buhay.

23. Ang kalayaan ay hindi dapat nakasira sa kapakanan ng ibang tao.

24. At være bevidst om vores handlinger og beslutninger kan hjælpe os med at undgå at skade andre og os selv.

25. Puwede bang makausap si Maria?

26. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

27. Hinayaan kong maglabas ng malalim na himutok ang aking kaluluwa upang mapawi ang aking pangamba.

28. Nang gabi ngang iyon ay hinintay ni Mariang Maganda ang kanyang iniirog.

29. The lightweight construction of the bicycle made it ideal for racing.

30. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

31. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

32. Ibinigay ko ang aking tulong sa mga naghihirap upang masiguro ang kanilang kaligtasan.

33. Magpapakabait napo ako, peksman.

34. Kahit mayroon akong mga agam-agam, hindi ko ito dapat ikumpara sa iba dahil may kanya-kanyang paghihirap ang bawat isa.

35. J'ai acheté un nouveau sac à main aujourd'hui.

36. The genetic material allows the virus to reproduce inside host cells and take over their machinery.

37. She is not designing a new website this week.

38. Platforms like YouTube, TikTok, and Twitch make it easy to share your content and reach a large audience

39. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

40. Marahil ay hindi ka na magkakaroon ng pagkakataon na gawin ang bagay na ito.

41. La realidad es que las cosas no siempre salen como uno espera.

42. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

43. Mathematics provides the foundation for other sciences, such as physics and engineering.

44. Ikaw na nga lang, hindi pa ako nagugutom eh.

45. They are not shopping at the mall right now.

46. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

47. Ano hong klaseng sawsawan ang gusto ninyo?

48. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

49. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

50. Abs yan!! Tingnan mo nga oh! May mga guhit guhit!

Recent Searches

pocaconvertidaskabibidagaibalikarghcommunitypakainpeepmuliirogreservedimaginationkaraokeinterestcornersprobablementemaaringprovenagtatanimsupilinbinabaanikinagagalakfistsstagedebatestsaacountriesadventcompartenjamesdaangleadprogressoftenrefgenerabalasingitlogrelevantpowersrepresentativeskinagalitanmahawaankahulugankarangalanpetpagsambapagkainisngititulisansponsorships,tumakbopinagtagpoturonaspirationnahuhumalingpang-araw-arawrestaurantidiomayatabinigaytinaybagdalandanmagsasalitataga-ochandongunitkatotohananbigangkanactivityneedlessmaingatpasyentenarinigalikabukinrizalitimmind:pinag-aaralanpresentapanitikan,nahihiloabstainingsinghalmaramotpinakamagalingtatlopahabolkulisapdumatingpronounsunud-sunuranyoungmaisginugunitapinapatapostatagallumiwagkalakihanskirtaanhinmasagananggrocerybumahaipapaputolvistrenatokasoipanlinisnamemalapitpossibleplatformpsheffortsahitbarnesmalapaddettenegativemaratingdigitalstoplightstyleseveneksaytedcomputere,katandaanlegislationaudiencestruggledblusavelstandsinusuklalyanna-fundmagpapigilnaglulutonapalitangnanamannagliliwanagpinakamahalagangihandanawawalapinahalatabloggers,nagpaiyakbibisitamarketplacesvisualnareklamonaglokomasasayabisitanamataypakakatandaanmagsi-skiingpanlolokotumaposkisapmatacompanieskaliwatuktoknapakabilisnagbabalamailaplumiithirambintananewsbusiness:matumalrolandamendmentstondorepublicaninventionbaguiobunutanmalasutlasiguroaustraliarightsnagplaygawingunconstitutionalponglinawwasakkuyalipatkendismileslavemarahilglobalcivilizationrabesearch