Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "convertidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Ang pag-asa ay nagbibigay ng mga oportunidad para sa mga tao upang maabot ang kanilang mga pangarap at mga layunin sa buhay.

2. Pagkatapos kong maglaba ay pupunta na ako sa mall.

3. O sige na, sige na! Tumahan ka na lang!

4. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

5. Sa gitna ng katahimikan, nakita ko siyang tulala sa kanyang pag-iisip.

6. Psss. si Maico saka di na nagsalita.

7. Gusto. pag-amin ko kasi gutom na gutom na talaga ako.

8. Maraming Pinoy ang nagta-trabaho sa ibang bansa bilang OFW.

9. Tesla is known for its innovative electric car models, including the Model S, Model 3, Model X, and Model Y.

10. Kings may wield absolute or constitutional power depending on their country's system of government.

11. Les patients sont suivis de près par les professionnels de santé pour s'assurer de leur rétablissement.

12. Mura lang ang mga damit sa Greenhills.

13. She is not cooking dinner tonight.

14. The host introduced us to his wife, a beautiful lady with a charming personality.

15. "Hindi lahat ng kumikinang ay ginto," ani ng matandang pantas.

16. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

17. Binilhan ni Fidel ng bulaklak si Imelda.

18. The United States has a system of federalism, where power is divided between the national government and the individual states

19. I am enjoying the beautiful weather.

20. Tomar decisiones que están en línea con nuestra conciencia puede ayudarnos a construir una vida significativa y satisfactoria.

21. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

22. Paulit-ulit na niyang naririnig.

23. Pang-isahang kuwarto ang gusto niya.

24. He thought it was a big problem, but in reality it was just a storm in a teacup.

25. "Wag kang mag-alala" iyon lang ang sagot ng dalaga sa kanya

26. Some people have a sweet tooth and prefer sweet flavors over others.

27. Binabaan nanaman ako ng telepono!

28. Es un cultivo versátil que se puede utilizar para hacer alimento para humanos y animales, y también se utiliza en la producción de biocombustibles

29. Bakit siya ginaganoon ni Ogor?

30. Sira ang aircon sa kuwarto ni Pedro.

31. Patients may need to follow a post-hospitalization care plan, which may include medications, rehabilitation, or lifestyle changes.

32. La anaconda verde es una de las serpientes más grandes del mundo y es conocida por su capacidad para aplastar a sus presas.

33. Nandoon lamang pala si Maria sa library.

34. The decision to release the product early was a risky but ultimately successful strategy.

35. They have won the championship three times.

36. Nung nagplay na, una kong nakita yung sarili ko. Natutulog.

37. Ipinagbibili niya ang mga ito na may mataas na patong sa mga pobreng mangingisda.

38. Kilala si Marites bilang isang tsismosa sa kanilang baranggay.

39. Les enseignants peuvent utiliser diverses méthodes pédagogiques pour faciliter l'apprentissage des élèves.

40. James Madison, the fourth president of the United States, served from 1809 to 1817 and was known as the "Father of the Constitution."

41. May I know your name for networking purposes?

42. The movie was rated R, and therefore she wasn't allowed to watch it.

43. He will always be remembered as a legend who brought martial arts to the mainstream and changed the way the world looked at martial arts forever

44. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

45. The park has a variety of trails, suitable for different levels of hikers.

46. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

47. They are shopping at the mall.

48. Los sueños nos dan un propósito y una dirección en la vida. (Dreams give us a purpose and direction in life.)

49. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

50. Si Andres Bonifacio ay isang magiting na bayani.

Recent Searches

pagewideconvertidasdividesclientesinfluentialmulti-billionferrerourtrackclassroomyoungdingreennaabutanrenacentistainterviewingmitigateactormessagepracticesinvolveparatingimpactedappnasundoventasafenaawapalmapunong-punopinakamatapatmakikitulogdingginalbularyonasasalinanpaaralanmaibamakulitnabigkascinekagandamakakawawayouthbokreadersdidingpalagaycigarettesbinabapaskongmaibabaliklilymaihaharapmakapagempakepagkaawanahihilobowltrentamaulitartificialfideltopicinyokasirobinhoodomfattendeadmiredvegasampliaumibigtagumpaynabigaykaraokedumilatunostenersandalikuwebaproductsnatulaklunestasamariloudiaperreynatayotagakpatutunguhankinagagalaktiniradoribinubulongmagkasintahanbangladeshpagsasalitanagsisipag-uwiannaglalatangmakikitaisulatliv,panghihiyangnawalangkinakabahankumaliwapasanbumisitalabing-siyamtatlumpungadvertising,nasasabihanpagkaimpaktokonsultasyonbulaklakpanalanginnangahaspaghaharutantinutopnakakarinigkumikilosimpormedisinakare-kareflyvemaskineronline,nagbabalabyggetlondonpumilialapaapasignaturatangekskongresonakatindigkulunganlinggongiinuminpumikittsonggoumiwasumokaypapalapitnaabotanumangmagkanopinalalayaspalamuticombatirlas,magsungitsumalamembersmagkasinggandaflaviodyipnaiinitanosakanaglabananmatulissundaekamustahikingnogensindepetsangisaaclendingblazing1920swaritransmitsonlinebingoiatfxixmininimizesusunduinbipolarboyetasinpinalutoseektryghedaccederginangrelevantexcuseleopartyjoykilopromotingfeelingcomeeveningkingproducirvedmalinisitinaliinteriorrelievedcrazy