Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "convertidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1.

2. Climate change is one of the most significant environmental challenges facing the world today.

3. Il peut y avoir des limites d'âge pour participer aux activités de jeu.

4. Bawal magtapon ng basura sa dagat dahil ito ay nakakasira sa buhay ng mga isda at iba pang karagatan.

5. Time heals all wounds.

6. Fødslen kan være en tid til at reflektere over ens egne værdier og prioriteringer.

7. "Ang buhay ay parang gulong, minsan nasa taas, minsan nasa baba," ani ng matandang nagkukuwento.

8. Women have faced discrimination and barriers in many areas of life, including education and employment.

9. Bawal ang maingay sa library.

10. Despite his success, Presley's personal life was plagued by controversy

11. Sinuspinde ng pulisya ang operasyon sa paghuli ng salarin dahil sa kakulangan ng ebidensiya.

12. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

13. Ang bilis ng internet sa Singapore!

14. Nationalism has been used to mobilize people in times of war and crisis.

15. A quien madruga, Dios le ayuda. - The early bird catches the worm.

16. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

17. Football is a popular team sport that is played all over the world.

18. Privacy settings on Facebook allow users to control the visibility of their posts, profile information, and personal data.

19. Paglingon ko, nakita kong papalapit sakin si Lory.

20. Ang pag-ulan ay nagpawi ng init at tuyot sa lupa.

21. I am absolutely confident in my ability to succeed.

22. El arte es una forma de expresión humana.

23. Les encouragements et les récompenses peuvent être utilisés pour motiver les autres, mais il est important de ne pas les rendre dépendants de ces stimuli.

24. Sa halip na umalis ay lalong lumapit ang bata.

25. Si Pedro ay namamanhikan na sa pamilya ni Maria upang hingin ang kanilang pahintulot na magpakasal.

26. Sa panahon ng kahirapan, mahalaga ang mga kaulayaw na handang magbigay ng suporta.

27. El nacimiento de un hijo cambia la dinámica familiar y crea un lazo fuerte entre los miembros.

28. Lumalaon ay dumarami ang tao sa paligid at ang pulis na umuusig ay tila siyang-siya sa kanyang pagtatanong at pagsusulat sa kuwaderno.

29. Oh, kinaiinisan mo pala? Eh bakit naging paborito mo?

30. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

31. Forgiving someone doesn't mean that we have to trust them immediately; trust needs to be rebuilt over time.

32. Dogs can provide a sense of security and protection to their owners.

33. Las hojas de palma se usan a menudo para hacer sombreros y cestas.

34. Seryoso? Ngayon ka lang nakakaen sa fastfood? tanong ko.

35. Coffee is a popular beverage consumed by millions of people worldwide.

36. Ang nagmamahal sa sariling bayan, kayang magtiis at magsumikap.

37. Sebelum kelahiran, calon ibu sering mendapatkan perawatan khusus dari dukun bayi atau bidan.

38. Cate Blanchett is an acclaimed actress known for her performances in films such as "Blue Jasmine" and "Elizabeth."

39. Menjaga kesehatan fisik dan mental juga berperan penting dalam mencapai kebahagiaan yang berkelanjutan.

40. I woke up early to call my mom and wish her a happy birthday.

41. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

42. The Great Barrier Reef in Australia is a wonder of marine life and coral formations.

43. Narinig ni Ana ang boses ni Noel.

44. Hindi mo aakalaing maarte siya sa mga damit dahil hindi naman ito halata.

45. The team's colors are purple and gold, and they play their home games at the Staples Center.

46. Los powerbanks son populares entre los usuarios de teléfonos móviles y otros dispositivos electrónicos.

47. I discovered a new online game on a gaming website that I've been playing for hours.

48. Children's safety scissors have rounded tips to prevent accidental injuries.

49. The website's social media buttons make it easy for users to share content on their social networks.

50. Magsasalita na sana ako ng sumingit si Maico.

Recent Searches

tulangconvertidasnahihilosurveysuniversitiessinetumigiluniqueestablishedflybituindolyarnerissanagtitindaputaheparkingsukatmedidalolapaki-bukasiinumincornerandamingdistanciagospelnatabunani-rechargeokaydeteriorateumiiyakerrors,magkasing-edadonlyfarmbagayadangmalapadprospercigarettesallowsyunbatimungkahitaosmaliwanagsafeaddressmakisuyobefolkningensarililahatsidonalugmokgagambasunud-sunodsagasaandisappointdependusingmariebihirangtennistaleboyfriendmakulitnag-iinompalancadiseasesmulimauliniganbenefitsconvey,iikutanginawangpinakidalasantosstoplightnagtuturomapadalimatulogginagawasinagotmakaratinghinanakitt-shirtbuenalikodfilipinaikinagagalaklamangburgeranumangnovellesmeronpesoskanilastillbarriersrespektivesabadowaliskaya1954summernagbiyahebathalabaling00amiroghahatolmagsusunuransaronghugissakopxviimahigpitreleasedexperiencesmakilalatinitirhankailanmanmemoprogrammingstevestyrernegrospangkatexperts,kaninakongpagodbotenagpagawa1980makikikainmayamankalalaroroofstockdetinteriorduriadditionallyemnerbernardohapasinnaghihirapbalitangbalitasabipagkakapagsalitacommunicationmatangkadspecificmamimilisiyudadkumantaproperlybroadmustworkdaymakalingnilapitankuboagadnutsinalismanuscriptsharingprocesshinimas-himastutusinniyonspecialpag-akyatchadpaginiwanumiyakkananpagkakamalinakapangasawapeterbwahahahahahatataasbobotonakakasamatenidotelang1940paninigasnag-replysakupinnaggalaipagbilitsinagustobeyondsegundobinilingnanlilisikyouth