Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "convertidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. May pitong araw sa isang linggo.

2. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

3. May email address ka ba?

4. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

5. Gusto ko ang pansit na niluto mo.

6. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

7. Kung alam ko lang na ganito kasakit ang magiging parusa ko

8. Commuters are advised to check the traffic update before leaving their homes.

9. TikTok is a social media platform that allows users to create and share short-form videos.

10. Ano ang binili mo para kay Clara?

11. Nakarating na kami sa aming pupuntahan.

12. Yehey! si Mica sabay higa sa tabi ko.

13. Pangkaraniwang Araw sa Buhay ng Isang Tao

14. Sa oras na makaipon ako, bibili ako ng tiket.

15. Get your act together

16. Lumabas na ako ng cr. Nakatayo lang ako dun.

17. People often form cliques in high school based on shared interests - it's a classic example of birds of the same feather flocking together.

18. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

19. It's nothing. And you are? baling niya saken.

20. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

21.

22. Naging kaibigan ko muna ang aking nililigawan bago ko siya niligawan upang mas makilala ko siya nang husto.

23. Kucing di Indonesia sering dijadikan sebagai hewan peliharaan yang cocok untuk apartemen atau rumah kecil.

24. Keep studying and hang in there - you'll pass that test.

25. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

26. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

27. Layuan mo ang aking anak!

28. Taman Mini Indonesia Indah di Jakarta adalah tempat wisata yang menampilkan miniatur kebudayaan Indonesia dari 33 provinsi.

29. Anong kailangan mo? pabalang kong tanong.

30. Jodie at Robin ang pangalan nila.

31. Pagkatapos ay muling naglaro ng beyblade kasama ang mga pinsan.

32. In addition to his martial arts skills, Lee was also a talented actor and starred in several films, including The Big Boss, Fists of Fury and Enter the Dragon

33. Maganda ang bansang Japan.

34. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

35. Nawalan kami ng internet kaninang madaling araw.

36. The weather forecast said it would rain, but I didn't expect it to be raining cats and dogs like this.

37. She enjoys drinking coffee in the morning.

38. El orégano es una hierba típica de la cocina italiana, ideal para pizzas y pastas.

39. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

40. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

41. The patient's family history of high blood pressure increased his risk of developing the condition.

42. Ako ay nagtatanim ng mga puno ng niyog sa aming lupang sakahan.

43. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

44. She has made a lot of progress.

45. Alam ko na may karapatan ang bawat nilalang.

46. Det er vigtigt at tage hensyn til ens egne begrænsninger og sundhedstilstand, når man vælger en form for motion.

47. Dala ito marahil ng sumpa sa iyo ni Matesa.

48. Bis morgen! - See you tomorrow!

49. She has been exercising every day for a month.

50. Limitations can be frustrating and may cause feelings of disappointment and failure.

Recent Searches

sparkconvertidaskwebangwideritwallasingeroulammisasumasambasinipangisugasweetbatotelangbilinasimiloggearleopangingiminoosparebairdmeaninghaltaninogameenchantedellenibabathroughoutadditionallynaritoexperiencessumugodoutpostpalengkeinaloktandaprosperinteractilingdecreaseinvolveinfinitymagbubungapracticesbakeplanareanaroonthingbehalfnakataasenergitumawapunoiinuminnakasandigtuloykontingotherslawangumingisitumangokahusayannasasabihanaddingkinagagalakmesangriskisinuotmagagamitmagsaingmustmoviesmedikalulomay-bahaywasakpublishedmagsasalitabeginningsisasabadteachermagpahabaprogramming10thnanlalamigangkanhimnag-iisangtraditionaleducativashuertomakatibangkomaibabaliknakaramdamspamakatulogdooneducationdesisyonancomplicatednapaiyaknagtakabumaliksignalnagtuturoagepaidmatesadermaulitpublishing,kommunikerernalasinglangrodonaaffectlordbowlbigasignaturameronbaranggaybayawakkutodtuktoknapawitatlorolandsumindiminerviepauwimalalakinakakatandalilyeksportennearstorydinalawkinikilalangrelievedmahabaiconherramientasinfluencehidingwouldgotcosechar,manirahanmetodiskgawintungkodmakapagempakeitinatapatmagtakakamandagpasyentesinusuklalyanlaganapdinieveninglimosprocesocuentansamuformamovinglikeimagingthereforetiposkinghitferrerilonglinggomundorevolucionadohinipan-hipangumagalaw-galawoktubrepagsasalitapinakamahalagangposterpaglalabadamagasawangsabadongalbularyobuung-buotinaasantiniradormagpalibrelumakaspagkaraakumakain