Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "convertidas"

1. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

Random Sentences

1. Inflation kann auch durch eine Erhöhung der Nachfrage nach bestimmten Waren und Dienstleistungen verursacht werden.

2. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

3. Setelah kelahiran, bayi akan dianggap sebagai anggota baru dalam keluarga dan masyarakat.

4. Facebook allows users to send private messages, comment on posts, and engage in group discussions.

5. May I know your name so we can start off on the right foot?

6. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

7. Sinabihan siya ng magulang na huwag maging maramot sa kanyang mga kapatid.

8. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

9. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

10. Lingid sa lahat, si Tarcila ay isang diwata.

11. Tinawag nilang ranay ang insekto na katagalan ay naging anay.

12. Ang tubig-ulan ay isang mahalagang bahagi ng siklo ng tubig sa kalikasan.

13. Después de estudiar durante horas, necesito un descanso.

14. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

15. Ang kanyang tula ay punong-puno ng panaghoy at pag-asa.

16. The role of God in human affairs is often debated, with some people attributing all events to divine intervention and others emphasizing the importance of human agency and free will.

17. I love you so much.

18. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

19. Maundy Thursday is the day when Jesus celebrated the Last Supper with his disciples, washing their feet as a sign of humility and love.

20. Nakatuwaang kainin ng mga bata ang bunga.

21. Kumaliwa ka sa susunod na kanto.

22. ¿Qué planes tienes para el Día de los Enamorados?

23. This can generate passive income for you, but it does require some capital to get started

24. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

25. At sa tuwing tataas, hahanapin ako ng tingin sa baba at malungkot nangingitian.

26. Bukas ay pupunta kami sa isang medical mission.

27. Mga prutas ang tinitinda ng tindera.

28. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

29. The basketball court is divided into two halves, with each team playing offense and defense alternately.

30. Ang alin? iyamot na sabi ko habang nakapikit na.

31. Higupin ng halaman ang tubig mula sa lupa.

32. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

33. Hindi malinis ang tubig na iyan, bumili ka ng iba.

34. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

35. The team's colors are purple and gold, and they play their home games at the Staples Center.

36. Dahan dahan akong tumango.

37. ¿Cual es tu pasatiempo?

38. Sweetness can be balanced with other flavors to create a harmonious taste experience.

39. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

40. Hinanap nila ang magandang babae upang pasalamatan ngunit wala na ito.

41. I've been following the diet plan for a week, and so far so good.

42. Bigyan mo ng pera ang pulubi.

43. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

44. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

45. The phone rang late at night, and therefore she was hesitant to answer it.

46. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

47. I can tell you're beating around the bush because you're not looking me in the eye.

48. Environmental protection requires a long-term vision and commitment to future generations.

49. Ang hangin sa takipsilim ay malamig at presko.

50. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

Recent Searches

convertidasagapocalalargamemorialeconomicpagbahingfridayenchantedmatabafriesagosprosperbiggesthallalamgenerationerlabingmajordatikararatinghariluisfeelingoftefaultkasinggandaworkdaymichaelbeginninginspireddinalakaybiliseksammakabilifurthertomnamungamerekitcommunicateprotestablessrelieveditlogsamatungkodmakapilinghatesalapibinilingbackiginitgitthreetipincreasenutstinulak-tulaknakabulagtangnagpakunotviewpatutunguhanpagpasensyahannapakatalinoulitusanatutuwabugtongpagkabuhaylumiwagnagtatanongpaghahabipinapataposnagpepekekinasisindakanmaghihintay1970snagbentacountrymasayapagsusulitsanadespueskulangenglandmaghapongtatlongabastopanindangbalangpsssmangingisda11pmtinitirhannunodisplacementsakopsubalitfuelmariopopularizepaynamebroughtsobraskilleven4thpapuntaelenaikinatuwanapakamisteryosokinamumuhiantaga-nayonpresidentialmakahiramnakalipashumiwalaypeoplekaloobangpapanhikhuhlaruinhahahamuyairplanesmatangkadnahantadkontradeterminasyonpagkathimayinasthmachickenpoxnangencompassescapitalgrinssumalielectionsatentoguiltychambersconcernshellogotissuesmagkaharapinvesting:dumagundonguwaksinasabipeksmankagipitanibinalitangyakapinwealthvillagevasquesvampiresgagamitnanamanlumindoluulaminupangunconventionalniyosakyanalanganumiwasumagangunospagsidlanrequierentumalontumalimharapantulalatransmitidastransitsampungtindahantelebisyontechnologicalteachtaoskumapithinukaykanilatangeksnapilitangahasinnovationtanawantoknasuklamtamadsurroundingsstyles